KEGG   Mus caroli (Ryukyu mouse): 110283771
Entry
110283771         CDS       T05910                                 

Gene name
Dll1
Definition
(RefSeq) delta-like protein 1
  KO
K06051  delta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110283771 (Dll1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110283771 (Dll1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283771 (Dll1)
  09162 Cancer: specific types
   05224 Breast cancer
    110283771 (Dll1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110283771 (Dll1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_3 EGF_CA EGF_2 ECSCR
Other DBs
NCBI-GeneID: 110283771
NCBI-ProteinID: XP_021004910
Ensembl: MGP_CAROLIEiJ_G0021093
UniProt: A0A6P5NT55
LinkDB
Position
17
AA seq 722 aa
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPAGFSGFNCEKKMDLCGSSPCSNGAKCV
DLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAP
VSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMVVDLSERHMESQG
GPFPWVAVCAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPEPCGGETETMNNLANCQREK
DVSVSIIGATQIKNTNKKADFHGDHGAEKSSFKVRYPTVDYNLVRDLKGDEATVRDTHSK
RDTKCQSQSSAGEEKIAPTLRGGEVPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIAT
EV
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgggccgtcggagcgcgctagcccttgccgtggtctcagccctgctgtgccaggtctgg
agctccggcgtatttgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggctctggcccgccgtgcgcctgcaggaccttctttcgc
gtatgcctcaagcactaccaggccagcgtgtcaccggagccaccctgcacctacggcagt
gcagtcacgccagtgctgggtgtcgactccttcagcctgcctgatggcgcaggcatcgac
cccgccttcagcaaccccatccgattccccttcggcttcacctggccaggtaccttctct
ctgatcattgaagccctccatacagattctcctgatgacctcgcaacagaaaacccagaa
agactcatcagccgcctcaccacacagaggcacctcactgtgggagaagaatggtctcag
gaccttcacagtagcggccgcacagacctccggtactcttaccggtttgtgtgtgacgaa
cactactacggagaaggttgctcggtgttctgccgacctcgggatgatgcctttggccac
ttcacctgcggggacagaggggagaagatgtgtgaccctggctggaaaggccagtactgc
actgacccaatctgtctgccagggtgtgatgaccaacatggatactgtgacaaaccaggg
gagtgcaagtgcagagttggctggcagggccgctactgcgatgagtgcatccgataccca
ggttgtctccatggcacctgccagcaaccctggcagtgtaactgccaggaaggctggggg
ggccttttctgcaaccaagacctgaactactgtactcaccataagccatgcaggaatgga
gccacctgcaccaacacgggccaggggagctacacatgttcctgccgacctgggtataca
ggtgccaactgtgagctggaagtagatgagtgtgctcccagcccctgcaagaacggagcg
agctgcacggaccttgaggacagcttctcttgcacctgccctcccggcttctatggcaag
gtctgtgagctgagcgctatgacctgtgcagatggcccttgcttcaatggaggacgatgt
tcagataaccctgatggaggctacacctgccattgccctgcgggcttctctggcttcaac
tgtgagaagaagatggatctctgtggctcttccccttgttctaacggtgccaagtgtgtg
gacctcggcaactcttacctgtgccgatgccaggctggcttctccgggaggtactgcgag
gacaatgtggatgactgtgcctcctccccgtgtgcaaatgggggcacctgccgggacagt
gtgaacgacttctcctgtacctgcccacctggctatacgggcaagaactgcagcgcccct
gtcagcaggtgtgagcatgcaccctgccataatggggccacctgccaccagaggggccag
cgctacatgtgtgagtgcgcccagggctatggcggccccaactgccagttcctgctccct
gagccaccaccagggcccatggtggtggacctcagtgagaggcatatggaaagccagggc
gggcccttcccctgggtggccgtgtgtgccggggtggtgcttgtcctcctgctgctgctg
ggctgtgctgctgtggtggtctgcgtccggctgaagctacagaaacaccagcctccacct
gaaccctgtgggggagagacagagaccatgaacaacctagccaattgccagcgcgagaag
gacgtttcagttagcatcattggggctacccagatcaagaacaccaacaagaaggcggac
tttcacggggaccatggagccgagaagagcagctttaaggtccgatatcccactgtggac
tataacctcgttcgagacctcaagggagatgaagccacggtcagggatacacacagcaaa
cgtgacaccaagtgccagtcacagagctctgcaggagaagagaagatcgccccaacactt
aggggtggggaggttcctgacagaaaaaggccagagtctgtctactctacttcaaaggac
accaagtaccagtcggtgtatgttctgtctgcagaaaaggatgagtgtgttatagcgact
gaggtgtaa

KEGG   Mus caroli (Ryukyu mouse): 110284642
Entry
110284642         CDS       T05910                                 

Gene name
Dll4
Definition
(RefSeq) delta-like protein 4 isoform X1
  KO
K06051  delta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110284642 (Dll4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110284642 (Dll4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284642 (Dll4)
  09162 Cancer: specific types
   05224 Breast cancer
    110284642 (Dll4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110284642 (Dll4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 Ly49 TMEM154
Other DBs
NCBI-GeneID: 110284642
NCBI-ProteinID: XP_021006115
Ensembl: MGP_CAROLIEiJ_G0024142
UniProt: A0A6P5NY48
LinkDB
Position
2
AA seq 686 aa
MTPASRSACRWALLLLAVLWPQQRAAGSGIFQLRLQEFVNQRGMLANGQFCEPGCRTFFR
ICLKHFQATFSEGPCTFGNVSTPVLGTNSFVVRDKNSGSGRNPLQLPFNFTWPGTFSLNI
QAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKVWRTDEQNDTLTRLSYSYRVICSDNY
YGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDEC
ICRPGWQGRLCNECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGST
CSNSGPKGYTCTCLPGYTGEHCELGLSKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHC
EHSTLTCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLN
RGPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRI
TQDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLV
VLLVLLVMVVVAVRQLRLRRPDDESREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCG
LDKFNCDKLQNHTLDYNLAPGLLGQGSMPGKYPHSDKSLGEKVPLRLHSEKPECRISAIC
SPRDSMYQSVCLISEERNECVIATEV
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgacgcctgcgtcccggagcgcctgtcgctgggcgctactgctgctggcggtactgtgg
ccgcagcagcgtgctgcgggctccggcatcttccagctgcggctgcaggagttcgtcaac
cagcgcggtatgctggccaatgggcagttctgcgaaccgggctgccggactttcttccgc
atctgccttaagcacttccaggcaaccttctccgagggaccctgcacctttggcaatgtc
tccacgcccgtattgggcaccaactccttcgtcgtcagggacaagaatagcggcagtggt
cgcaaccctctgcagttgcccttcaatttcacctggccgggaaccttctcactcaacatc
caagcttggcacaccccgggagacgacctgcggccagagacttcaccaggaaattcgctt
atcagccaaatcatcatccaaggctcccttgctgtgggtaaggtttggcgaacagatgag
caaaatgacaccctcaccagactgagctactcttaccgggtcatctgcagtgacaactac
tatggagagagctgttctcgcctgtgcaagaagcgagatgaccacttcggacattatgag
tgccagccagatggcagcctgtcttgcctgccgggctggactgggaagtactgtgaccag
cctatatgtctttctggctgtcatgagcagaatggttactgcagcaagccagatgagtgc
atctgccgtccaggttggcagggtcgcctgtgcaatgaatgtatcccccataatggctgt
cgtcatggcacctgcagcatcccctggcagtgtgcctgcgatgagggatggggaggtctg
ttttgtgaccaagatctcaactactgcactcaccactctccgtgcaagaatggatcaacg
tgttccaacagtgggccaaagggttatacctgcacctgtctcccaggctacactggtgag
cactgtgagctaggactcagcaagtgtgccagcaacccctgtcgaaatggtggcagctgt
aaggaccaggagaatagctaccactgcctgtgtcccccaggctactatggccagcactgt
gagcatagtaccttgacctgtgcggactcaccctgcttcaatgggggctcttgccgggag
cgcaaccagggggccagttatgcctgcgaatgcccccccaactttaccggctctaactgt
gagaagaaagtagacaggtgtaccagcaacccgtgtgccaatggaggccagtgcctgaac
agaggtccaagccgaacctgccgctgccggcctggattcacaggcacccactgtgaactg
cacatcagtgattgtgcccgaagtccctgtgcccacgggggcacttgccacgatctggag
aatgggcctgtgtgcacctgccccgctggcttctctggcaggcgctgcgaggtgcggata
acccaggatgcctgtgcctccggaccctgcttcaatggggccacctgctacaccggcctc
tccccaaacaacttcgtctgcaactgtccttatggctttgtgggcagccgctgcgagttt
cccgtgggcttgccacccagcttcccctgggtagccgtctcgctgggcgtggggctggtg
gtactgctggtgctgctggtcatggtggtagtggctgtgcggcagctgcggcttcggagg
cccgacgacgagagcagggaagccatgaacaatctgtcagacttccagaaggacaaccta
atccctgccgcgcagctcaagaacacgaaccagaagaaggagctggaagtggactgtggc
ctggacaagttcaactgtgacaaactgcagaaccacacgttggactacaatctagccccg
ggactcctagggcagggcagcatgcctgggaagtatcctcacagtgacaagagcttagga
gagaaggtgccacttcggttacacagtgagaagccagagtgtcgaatatcagccatttgc
tctcccagggactctatgtaccagtcagtgtgtttgatatcagaagagaggaacgagtgt
gtcattgccacagaggtataa

KEGG   Mus caroli (Ryukyu mouse): 110298934
Entry
110298934         CDS       T05910                                 

Gene name
Dll3
Definition
(RefSeq) delta-like protein 3 isoform X1
  KO
K06051  delta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110298934 (Dll3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110298934 (Dll3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298934 (Dll3)
  09162 Cancer: specific types
   05224 Breast cancer
    110298934 (Dll3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110298934 (Dll3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 DSL EGF_CA
Other DBs
NCBI-GeneID: 110298934
NCBI-ProteinID: XP_021024138
Ensembl: MGP_CAROLIEiJ_G0029439
UniProt: A0A6P5QAB6
LinkDB
Position
7
AA seq 592 aa
MVSLQVSPLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRV
CLKPGVSQEATESLCALGTALSTSVPVYTQHPGESAAALPLPDGLVRVPFRDAWPGTFSL
VIETWREQLGEHAGGPAWNLLARVAGRRRLAAGGPWARDVQRTGTWELHFSYRARCEPPA
VGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPPVCRAGCSPEHGYCEEPDECRCLEG
WTGPLCTVPVSTSSCLNSRVPGPASTGCLLPGPGPCDGNPCANGGSCSETPGSFECACPR
GFYGLRCEVSGVTCADGPCFNGGLCVGGEDPDSAYICHCPPGFQGSNCEKRVDRCSLQPC
QNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGSRRCSCALGFG
GRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGVRCEFAVRPDGADAVPAAPRG
LRQADPQRFLLPPALGLLAAAGLAGAALLLIHVRRRGPGQDTGTRLLSGTREPSVHTLPD
ALNNLRLQDGAGDGPSSSADWNHPEDGNSRSIYVIPAPSIYAREDWLIQVLF
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggtctctctgcaggtgtctccgcttccccagacgctgatcctggcttttctccttcct
caggcactgccggctggtgtcttcgagctacaaattcattctttcgggccaggcccaggc
cccgggaccccacgctccccctgcaacgcccgaggcccttgccgcctcttcttcagggtt
tgcctgaagcccggagtctcccaggaggccaccgagtccctgtgcgccctgggcacagca
ctgagcacgagcgtcccggtctatacgcagcaccccggagagtcagcggctgccctgccg
ctgcctgatggcctcgtacgtgtgcccttccgcgatgcttggccgggcaccttctccctc
gtcattgaaacctggagagagcagctgggagagcatgctggagggcccgcctggaacctg
ctagcacgtgtggccggccgcagacgcctggcggctgggggcccgtgggcccgcgatgtg
cagcgcacaggcacatgggagttgcacttctcctaccgcgcgcgctgcgagccgcccgcc
gtcggggccgcctgcgcgcgcctgtgccgctcacgcagtgccccctcgcggtgtggcccg
ggactgcgaccctgcacgccattcccagacgagtgcgaagccccgcctgtgtgtcgagca
ggctgcagcccggagcacggctactgtgaagagcctgatgaatgccgttgcctggagggc
tggactggacccctctgcacggtccctgtctccaccagtagctgcctgaactccagggtc
cctggtcctgccagcactggatgccttttacctgggcctggaccttgtgatgggaaccca
tgtgccaatgggggcagctgtagtgaaacccctggctcctttgaatgtgcctgtccccgg
ggattctacggacttcgatgtgaggtgagcggggtcacgtgcgcagatggaccctgcttc
aatggcggcttgtgtgttggcggtgaagatcctgactctgcctatatctgtcattgccca
cctggtttccaaggctctaactgtgagaagagggtggaccgctgtagcctgcagccatgt
cagaatggcggcctctgcctggacctgggccatgcgttgcgctgccgctgtcgcgcggga
ttcgccgggccgcgctgcgagcacgacctggacgactgcgccggccgcgcctgtgccaac
ggcggcacgtgcgtggagggcggcggctcgcgccgctgctcgtgtgcgctgggcttcggc
gggcgcgactgccgggaacgcgccgacccctgcgcctcccgcccctgcgcgcatggaggc
cgttgctacgcccacttctctggcctggtctgcgcctgcgcgcccggctacatgggcgtg
agatgcgagttcgccgtgcgcccggacggcgcggacgcggtgcctgcggccccacggggc
ctgaggcaggcggatccacagcgctttcttctgcctcccgccttggggctgctggcggcc
gccggtttggctggcgccgcactcttgctcatccacgttcgccgccgaggtcctggccag
gataccgggactcgcctgctttctgggacccgggaaccttcggtccacacgctcccggat
gcactcaacaacctgaggttacaagacggtgctggggatggccccagttcgtcggctgac
tggaatcatcctgaagatggaaactctagatccatttatgtcataccagccccttccatt
tatgcaagagaggattggttgatccaggtcttgttctag

DBGET integrated database retrieval system