KEGG   Mus caroli (Ryukyu mouse): 110283813
Entry
110283813         CDS       T05910                                 

Gene name
Ticam1
Definition
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110283813 (Ticam1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110283813 (Ticam1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110283813 (Ticam1)
   04621 NOD-like receptor signaling pathway
    110283813 (Ticam1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110283813 (Ticam1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110283813 (Ticam1)
   05133 Pertussis
    110283813 (Ticam1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110283813 (Ticam1)
   05160 Hepatitis C
    110283813 (Ticam1)
   05164 Influenza A
    110283813 (Ticam1)
   05168 Herpes simplex virus 1 infection
    110283813 (Ticam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283813 (Ticam1)
   05165 Human papillomavirus infection
    110283813 (Ticam1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110283813 (Ticam1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 110283813
NCBI-ProteinID: XP_021004996
Ensembl: MGP_CAROLIEiJ_G0021772
UniProt: A0A6P5NYY4
LinkDB
Position
17
AA seq 751 aa
MDNPGPSLHGAFGILGALERDRLTSLKHKLGSLRSGSQESKLLHAMVLLALGQDTEARVS
LESLKMNTVAQLVAHQWADMESTEGPEEPPDLSWTVARLYHLLAEENLCPGSTRDIAYQV
ALRDLASQGDHQLGQLQNEAWDRCSSDIKGDPSGFQPLHSHQGSLQPPSASPAVTRSQPC
PIDTPDWSWGHTLHSTNSTASLASHLEISQSPTLAFLSSHHGTHGPSKLCNTPLDTQEPQ
LVPEGCQDPEEISWPPSVETSVSSGLPHEISVPEVSPEEASPILPDTLAAPDTSVHCPIE
CTESLSTNSRSPLTSTTESVGKQWPITSQRSPQVPVGDDSLQNTTSSSPPAQPPSLQASP
MLPPSPQSSASSPSSYPAPPTSTSPILDHSETSDQKFYNFVVIHARADEQVALRIREKLE
TLGVPDGATFCEEFQVPGRGELHCLQDAIDHSGFMILLLTASFDCRLSLHQVNHALMNSL
TQSGRQDCVIPLLPLECSQAQLSPDTTRLLHSIVWLDEHSPIFARKVANTFKTQKLQAQR
LRWKKEQEARTLKEQSIQLEAERQNVAAISDAYTAYVHSYRAWQAEINRLGVAFGKNLSL
GTPTPSWPGCPQPTPSHPQGGTPVSPYSPQPPSFPQPPYFLQPPSFPQPPSFPQPPCFPQ
PPSFPQPPSFPLPPVSSPQSQSFPSASSPAPQTPGPQPLIIHHAQMVQVGVNNHMWGHTG
AQSSDDKSECLENPCMGPLTDQGGPLLETPE
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggataacccagggccttctctccatggtgcctttggcattctaggtgccttggaaagg
gacaggctgaccagcctgaaacacaagctggggagtctgcgttcaggcagccaggagtca
aagcttctccatgctatggtactcctggctctgggccaggacacggaggccagggtctct
ctggagtccttgaagatgaacacagtagcccagctggtagcccaccagtgggcagacatg
gagagcacagagggccctgaggagcctccagacttgtcctggacggtggctcgcctgtac
cacctgctggctgaggagaacctgtgtccgggctccacaagggacatcgcttaccaggtg
gcccttcgtgaccttgcctcccagggtgaccaccagctgggccaactccagaatgaggcc
tgggatcggtgcagttcagacatcaagggggaccccagtggtttccagccactccattct
catcagggttccctgcagccaccttcagcatcccctgcagtgaccagaagccagccttgt
cccattgacacaccagactggagttggggacatacgttacactccaccaacagcactgcc
tcactggccagccacctagagatcagccagtcacccactcttgcctttctctcttcacac
catggaacccatgggcccagcaagctatgtaacacaccgctggacactcaggagcctcag
cttgtccctgaaggctgccaagatccagaggagatcagctggcctccatcagtggagacc
agtgtctcctcagggttaccacacgaaattagcgtcccagaggtgtctccagaagaggct
tcgcccatcctccctgacaccctggctgctccagacacaagtgtccactgtcccattgag
tgcacagagtctctgtctacaaactccaggtctcccctgacgtccactacagaaagtgtt
ggaaagcagtggcctatcacaagtcagaggtcacctcaagttcctgtaggagatgattct
ctgcagaacacaacgtcatccagccctcctgcccagccaccatccctccaagcctcccct
atgctgcctccttcccctcagtcctctgcttcctccccgagcagctaccctgctcctcca
acctccacatcccctattctggaccactcagaaacatctgatcagaaattctataacttt
gtggtcatccatgccagggctgatgaacaggtggccctacgtattcgggagaagctggag
accctcggggtacctgacggggccaccttctgtgaggaatttcaggtgcccgggcgtggt
gagctgcactgtctccaagatgccattgatcactcagggttcatgatcctgctcctgact
gctagctttgattgccgcctgagcctacatcaagtcaaccatgctctcatgaacagcctc
acacagtctgggaggcaggactgtgtgatccccctcctcccacttgagtgttcccaggcc
cagctcagcccagatacaaccagactgctccacagcattgtgtggctagatgaacactcc
ccaatctttgccagaaaggtggcaaacaccttcaagacacagaagctccaggcacagcgg
ctacgttggaagaaagagcaggaggccagaaccctcaaggagcagagcatacagctggag
gcggagcggcaaaacgtggcggccatatctgatgcctacacagcctatgtccatagctac
agggcctggcaagcagagataaacagacttggggtggcttttgggaagaatttgtcactg
gggaccccaacacccagctggcctggatgtccacagccaacaccttctcatcctcagggt
ggtactccagtttccccctattccccacagcctccatccttccctcagcctccatacttc
cttcagcctccatccttccctcagcctccatccttccctcagcctccatgcttccctcag
cctccatccttcccacagcctccatccttcccactgcctccagtctcttctccacagtcc
caatcctttccatcagcctcctccccagccccacagactccaggacctcagcctctcatt
attcaccatgcccagatggttcaggtgggtgtcaacaaccacatgtggggccacacaggg
gcccagtcatctgatgacaagagtgagtgtttggagaatccctgcatgggccctctgact
gaccagggcggaccccttcttgagactccagagtga

DBGET integrated database retrieval system