KEGG   Mus caroli (Ryukyu mouse): 110283823
Entry
110283823         CDS       T05910                                 

Gene name
Ralbp1
Definition
(RefSeq) ralA-binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal05200  Pathways in cancer
mcal05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110283823 (Ralbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283823 (Ralbp1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110283823 (Ralbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110283823 (Ralbp1)
Membrane trafficking [BR:mcal04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    110283823 (Ralbp1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 110283823
NCBI-ProteinID: XP_021005011
Ensembl: MGP_CAROLIEiJ_G0021832
UniProt: A0A6P5NQQ6
LinkDB
Position
17
AA seq 648 aa
MTECFLPPTSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDT
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVKRPKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
MDAPSLKPIFGVPLADAVERTMMYDGVRLPAVFRECVDYMERHGMKCEGVYRVSGIKSKV
DELKAAYDREESPNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKATEMEKV
QEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVL
FTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQLILEDLQRQNEELEIKNNHLNQAVHEEREAIIELRVQLRLLQMQRAK
SEQQPQEEEEPERRGGAGPPPCDGVLEVRVAKEQAKASPSKDRKETPI
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccctagtgaacaccgcagggccgaacat
ggcagtgggctaacccggacccccagctctgaggagatcagccctacaaagttccctgga
ttgtaccggacgggtgagccctcgcctccccatgacatcctccatgagcctcctgataca
gtgtcagatgatgagaaagaccatggaaagaaaaaagggaaatttaagaaaaaggagaaa
aggactgaaggctacgctgccttccaagaagacagctctggagatgaagctgaaagtcct
tccaaggtgaagaggcccaagggaatccatgtgttcaaaaagcccagtttctctaaaaag
aaggaaaaagattttaaaatcaaagaaaaacccaaagaagaaaagcataaagaggaaaag
cacaaagaggaaaagcataaagaaaagaaatcgaaagacttgacagcagccgatgttgtt
aaacagtggaaggagaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
atggacgcgccgagtctcaagcccatttttggggttcccttggctgacgcagtagagagg
accatgatgtatgacggcgtccggctgccagctgtcttccgggagtgtgtggactacatg
gagaggcacggcatgaagtgtgaaggcgtctaccgggtgtcaggaatcaaatcaaaggta
gatgagctaaaagcagcctatgaccgagaggagtctccaaacttagaagactatgagcct
aacactgtagccagcttgctgaagcagtatctgcgagaccttcccgagaatttgcttacc
aaagagcttatgccccgatttgaagaggcctgtgggaaggccacagagatggagaaagtg
caggaattccagcgcttgctccgggaactgcccgagtgcaatcatcttctgctttcctgg
ctcattgtgcacctggaccacgtcatcgcaaaggagctggagacgaagatgaacatccag
aacatctctatagtgctgagccccaccgtgcagatcagcaatcgagtcctgtacgtgctt
ttcacacatgtgcaagagctctttggcaccgtggtcctgaagcaagtaacaagacctctg
cggtggtccaacatggccacaatgcccacactgccagagacccaagcaggcatcaaggag
gagatccggagacaggagttccttttgaattgtttacatcgagatctgcagggcgggata
aaggacttatctaaagaagaaagattatgggaagtacagaggattctgactgccctcaag
agaaagctgagggaagctaaaagacaagagtgtgaaaccaagattgcacaggagatagct
agtctttcgaaagaggatgtttccaaagaagaaatgaatgaaaacgaagaagttataaat
atccttcttgcccaggagaatgaaatcctgactgaacaggaggagctcctggccatggag
cagttcctgcgtcgtcagattgcctcagagaaagaagagatcgaccgcctgcgagctgag
attgcagagatccagagccgtcagcagcatggccgcagtgagacggaggagtactcgtct
gacagcgagagcgagagcgaggacgaggaggagctgcagctcattctggaagacctgcag
cggcagaacgaggagttagaaataaagaacaatcacttgaaccaagcagtccatgaggag
cgggaggccatcatcgagctccgagtgcagctccggctgctccagatgcagcgagccaag
tctgagcagcagccgcaggaggaggaggagcccgagaggcgaggaggcgcaggcccaccg
ccctgtgacggtgtcctcgaggtgagggtagccaaggagcaggcgaaggcctcacccagc
aaagaccggaaggagacgcccatctga

DBGET integrated database retrieval system