KEGG   Mus caroli (Ryukyu mouse): 110283954Help
Entry
110283954         CDS       T05910                                 

Gene name
Rhag
Definition
(RefSeq) ammonium transporter Rh type A
  KO
K06580  ammonium transporter Rh
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110283954 (Rhag)
   04090 CD molecules [BR:mcal04090]
    110283954 (Rhag)
Transporters [BR:mcal02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   110283954 (Rhag)
CD molecules [BR:mcal04090]
 Proteins
  110283954 (Rhag)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 110283954
NCBI-ProteinID: XP_021005166
Ensembl: MGP_CAROLIEiJ_G0021616
LinkDB All DBs
Position
17
AA seq 438 aa AA seqDB search
MRFKFPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNATQQGNTSSSAKKGQFFQL
YPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGEEFHF
GIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVNELFQASDTGA
SMTIHAFGAYFGLAVAGVLYRPGLRCEHPNEESVYHSDLFAMIGTLFLWIFWPSFNSAIA
DLGNHQYRAIVNTYMSLAACVITAYALSSLVERRGRLDMVHIQNATLAGGVAVGTCADME
IPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLPGVFGGLASIVAIS
WGMSTGSMAMQAAALGSSIGSAIVGGLLTGLILKLPVWNQPPDEYCFDDCVSWKVPKFRE
LDNRFFQHANHNHVEHEV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcaaattccctctcatggccataagcctggaagttgctatgattgttttattt
ggattatttgttgaatatgagacaccgcagaatgcttcccagaagaatgcttcccaccag
aatgctacccagcagggtaatacctcaagttcagcaaaaaagggccaattttttcagttg
tatcccttattccaagatgtgcatgtcatgatatttgttgggtttggcttcctcatgacc
tttctgaagaaatatggtttcagtggtgtgggtttcaacctctttcttgctgctctgggc
ctccaatggggtacaattatgcaaggccttcttcacagccacggagaggaatttcacttc
ggaatctacaatatgataaatgcagacttcagcacagccacagttctaatttcctttggc
gctgtcctggggaaaacaagccccattcaaatgttgatcatgaccattctggaaattgct
gtatttgctggcaatgaatatcttgttaatgaattatttcaggcatctgacactggagca
tcaatgacaatccatgcctttggagcttactttggcttagcagtagcaggtgtgttatat
cggcctggactcagatgtgaacacccaaatgaagaatctgtgtaccactctgacttgttt
gccatgatcggaacacttttcctgtggatattttggcccagctttaattcagccattgct
gatcttggaaatcatcagtatagggccattgtcaacacatacatgtcccttgcagcctgt
gtgatcacagcctatgccttgtccagccttgtggagcgccgaggcaggctggatatggta
cacattcagaatgctactctagcaggaggtgttgctgtgggcacatgtgcagacatggaa
atccccctatatgctgctatgaccattggaagcattgcagggatcatctctgtgcttgga
tacaagttctttagtccattgttagctaataaactgatgatccatgatacgtgtggggtt
cataacttgcatggcttacctggagtttttggaggccttgccagcattgtggccataagc
tgggggatgtctactgggtctatggctatgcaggcagcagcactgggatcttccattggc
tcagcgattgttggaggtttacttacaggtctaattctgaagttgcctgtctggaaccag
ccacctgatgaatactgctttgatgactgtgtttcttggaaggttcccaaattcagagaa
cttgataatcgcttctttcaacatgcgaatcacaaccacgtggaacatgaagtctaa

DBGET integrated database retrieval system