KEGG   Mus caroli (Ryukyu mouse): 110284040
Entry
110284040         CDS       T05910                                 

Gene name
Axin1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110284040 (Axin1)
   04390 Hippo signaling pathway
    110284040 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110284040 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284040 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284040 (Axin1)
   05225 Hepatocellular carcinoma
    110284040 (Axin1)
   05226 Gastric cancer
    110284040 (Axin1)
   05217 Basal cell carcinoma
    110284040 (Axin1)
   05213 Endometrial cancer
    110284040 (Axin1)
   05224 Breast cancer
    110284040 (Axin1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284040 (Axin1)
   05022 Pathways of neurodegeneration - multiple diseases
    110284040 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110284040 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284040 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110284040 (Axin1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110284040 (Axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 110284040
NCBI-ProteinID: XP_021005273
Ensembl: MGP_CAROLIEiJ_G0021274
UniProt: A0A6P5NTZ9
LinkDB
Position
17
AA seq 868 aa
MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSE
TSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLL
DFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQ
QIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMS
GYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLMETAAPRAPSSRRYNEGRELRYG
SWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRRE
MQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKR
VRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQ
RVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHH
HVHHNSARPKEQMEAEVARRVQSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTS
TSSKRNTKKAESGKNASAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQ
QAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRL
EEEEKRANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGG
GSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCG
VVFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcagagtcccaaaatgaatgtccaggagcagggtttccccttggacctcggagcaagt
ttcaccgaagatgccccccggcccccagtgcctggagaagagggagaactggtatctact
gattcgaggcctgtcaaccacagtttctgctctgggaaaggtaccagcattaaaagtgag
acctcaacagccaccccaagacgttcagatctggatctgggatatgagcccgagggcagt
gcctcccccaccccaccatatttgaggtgggctgagtcactgcattccttattggatgac
caagatgggatcagcctgttcaggactttcctgaagcaggagggctgtgctgacctgctg
gacttctggtttgcctgcagtggcttcaggaagcttgagccctgtgactcaaatgaggaa
aagaggctgaagctggcaagagccatctaccgaaagtacatcctggatagcaatggcatt
gtgtccagacaaaccaagccagccactaagagcttcataaaggactgtgtcatgaagcag
cagatcgatcctgccatgtttgaccaggcacagacagaaatccagtccaccatggaggag
aatacctacccttcctttcttaagtctgacatttatttggagtacacaaggacaggctca
gagagtccgaaggtctgcagtgaccagagctcagggtctggaacagggaagggcatgtct
ggatacctgcccactttgaatgaagatgaagaatggaaatgtgaccaagatgcagatgag
gatgatggccgagaccctctcccccccagcaggctcacccagaagctgctaatggagact
gctgccccgagggccccctcaagtagacggtacaacgaaggcagagagctcaggtatgga
tcttggagggagcccgtcaacccctactacgtcaactctggctatgccctggccccagcc
accagtgccaatgacagtgagcagcagagcctgtccagtgatgctgacactctatccctt
acggacagtagtgtggatggaatccccccatacaggatccgtaagcagcacagaagggag
atgcaggagagtatccaagtcaatgggcgggtacctctacctcacattcctcgcacttac
cgaatgccaaaggagatccgggtagagccacagaaatttgctgaagagcttattcaccgt
ctagaggctgtccagcgcactagagaggctgaagaaaagttggaggaacggctgaagcgt
gtacgcatggaggaagaaggggaggatggtgaaatgccttctggccccatggcaagtcac
aagctgccttctgtcccagcttggcaccatttcccaccccgctatgtggatatgggctgc
tctggactgcgggatgcccatgaggagaatcctgagagcatcctggatgagcatgtgcaa
agggtcatgaggacacctggctgccagtcacctggcccaggccaccgctctcctgacagt
gggcatgtggctaagactgcagtgctagggggtacagcctccgggcatgggaagcatgtt
cctaagttagggttgaagctggatacagctggccttcaccatcatagacatgtccaccac
catgttcaccataattcagctagacctaaggagcaaatggaggctgaagttgcccgcagg
gtccagagcagcttctcgtggggcccagaaacacatggtcatgccaagccccggagctat
tccgagaacgcaggcaccaccctcagtgctggagatttggcctttggtggtaaaactagt
acatcttccaaaagaaacaccaagaaggctgaatctgggaagaatgccagtgctgaggta
cccagtaccaccgaggacgcagagaagaaccagaagatcatgcagtggatcattgagggc
gagaaggagatcagtagacaccggaaggcaggccatgggtcttctgggttgaggaagcag
caggcccatgaaagctccaggcccttgtccatcgagcgtcctggggccgtgcacccttgg
gtcagcgctcagcttcggaactctgtccagccttctcatcttttcatccaagatcccaca
atgccacccaatccagcccctaatcccctgacccagctggaagaggcccgcaggcgtttg
gaagaagaagaaaagagagcaaacaaactgccctccaagcagaggtatgtgcaggcagtc
atgcagcggggacgcacctgtgtcaggccagcttgtgcaccggtgctgagtgtggtacca
gccgtgtcggacttggaactctccgagacagagacaaaatcacaaagaaaagcaggtggc
gggagtgcaccaccatgtgacagcattgttgtggcctactatttctgtggggaacccatc
ccctaccggaccctggtgaggggccgtgctgtcaccctgggccagttcaaggagctgcta
accaagaaggggagctacagatactactttaagaaagtgagtgacgagtttgactgtggt
gtggtatttgaggaagtacgggaggatgaggccgtcttgcctgtctttgaagaaaagatc
atcggcaaggtggaaaaggtggactga

KEGG   Mus caroli (Ryukyu mouse): 110304669
Entry
110304669         CDS       T05910                                 

Gene name
Axin2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110304669 (Axin2)
   04390 Hippo signaling pathway
    110304669 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110304669 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304669 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304669 (Axin2)
   05225 Hepatocellular carcinoma
    110304669 (Axin2)
   05226 Gastric cancer
    110304669 (Axin2)
   05217 Basal cell carcinoma
    110304669 (Axin2)
   05213 Endometrial cancer
    110304669 (Axin2)
   05224 Breast cancer
    110304669 (Axin2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110304669 (Axin2)
   05022 Pathways of neurodegeneration - multiple diseases
    110304669 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304669 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304669 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110304669 (Axin2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110304669 (Axin2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind SdrD_B
Other DBs
NCBI-GeneID: 110304669
NCBI-ProteinID: XP_021031801
Ensembl: MGP_CAROLIEiJ_G0017344
UniProt: A0A6P5QLM6
LinkDB
Position
11
AA seq 840 aa
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQQCH
TLLPTGGKLPPVSACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCL
CPGGTDYYCYSKCKSHLKAPEPLPGEQFCGSRGGTLPKRNAKGTEPGLALSARDGGMSSA
AGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESARAAPGERVSRHHL
LGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRD
RNHSAAGQAGASSFTNPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKA
QSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVEKID
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgagtagcgccgtgttagtgactctccttccagatcccagcagcagcttccgcgaggat
gctccgcggcccccggttccgggagaagaaggggagaccccaccgtgtcagcctagtgtg
ggcaaggtccagtccaccaaacctatgcccgtctcctctaatgctaggcggaatgaagat
ggactgggggagcccgaggggcgggcctcccccgattcccctttgaccaggtggaccaag
tctttgcactcattgttgggtgaccaggatggtgcatacctcttccggactttcctggag
agggagaaatgtgtggatactctggacttctggtttgcttgtaatgggttcaggcagatg
aacctgaaggataccaaaactttgcgagtggccaaagcaatctataagaggtacattgag
aacaacagcgttgtgtccaagcagctgaagcccgccaccaagacctacatacgagatggc
atcaagaagcaacagattggctcggtcatgtttgaccaggcacagaccgagatccaggcg
gtgatggaggaaaatgcctaccaggtgttcttgacttctgacatttacctggaatatgtg
aggagtgggggggaaaacacagcttacatgagtaacggggggctggggagcctaaaggtc
ttatgtggctacctccccaccttgaatgaagaagaggagtggacatgtgccgacctcaag
tgcaaactctcacccaccgtggttggcttgtccagcaaaactcttcgggccaccgcgagt
gtgagatccacggaaacagctgaaaacggattcaggtccttcaagagaagcgacccggtt
aatccttatcacgtaggttccggctatgtctttgcaccagccaccagcgccaacgacagc
gagttatccagcgacgcactgaccgatgattccatgtccatgacagacagtagcgtagat
ggaatccctccttaccgcatggggagtaagaaacagctccagagagagatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacgcctgtggaacctgctgccttcgccgccgagctcatctccaggctggagaaa
ctgaaactggagctggagagccgccatagtctggaggagcggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggtccag
caccccctggccctcctaccctccggcagctatgaagaggacccacaaaccattttggac
gaccacctctccagggtcctcaagacccccggctgtcaatcccctggtgtgggtcgctac
agcccgcggtcccgctcccccgaccaccaccaccagcaccaccaccatcagcagtgtcac
acccttcttccgactgggggcaagttgccccccgtgtctgcttgccccctccttggaggc
aagagcttcctgaccaaacagacgacgaagcacgttcaccaccactacatccaccaccac
gccgtccccaagaccaaggaggagatcgaggcagaagccacacagagagtccgctgcctc
tgtcctggaggaaccgattattactgctactccaaatgcaaaagccacctgaaggctcca
gagcccctgcctggggagcagttttgtggcagcagaggtggtaccttgccaaaacggaat
gcaaagggcacagaaccgggtcttgcactatcggccagggatggagggatgtccagtgca
gcgggggccccccagcttcctggggaagaaggagaccggtcacaggatgtctggcagtgg
atgttggagagtgagcggcagagcaagtccaagccccatagtgcccaaagcataagaaag
agctacccattggagtctgcccgtgcggccccaggagaacgagtcagccggcaccatctg
ttgggggccagcggacactcccgctcggtggcccgggctcacccatttacccaggaccct
gcaatgcctccccttaccccacccaatactttggcacagctggaggaagcctgccgcagg
ctggcagaggtgtcaaagccccagaagcagaggtgctgtgtggccagtcagcagagggac
aggaaccactcggccgctggtcaggcaggagcctcatccttcaccaacccaagcctggct
ccagaggatcacaaagagccaaagaaactggcaagtgtccacgcgctccaggccagtgag
ctggttgtcacctactttttctgtggcgaagaaattccatacaggaggatgctgaaggct
cagagcttgaccctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtat
tacttcaagaaggcgagtgatgaatttgcctgcggagcagtttttgaggagatctgggac
gacgagacagtgctccccatgtacgaaggcaggatcctgggcaaagtggagaagatcgac
tga

DBGET integrated database retrieval system