KEGG   Mus caroli (Ryukyu mouse): 110284093
Entry
110284093         CDS       T05910                                 

Gene name
Stk4
Definition
(RefSeq) serine/threonine-protein kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04068  FoxO signaling pathway
mcal05200  Pathways in cancer
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284093 (Stk4)
   04014 Ras signaling pathway
    110284093 (Stk4)
   04068 FoxO signaling pathway
    110284093 (Stk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284093 (Stk4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110284093 (Stk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110284093 (Stk4)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110284093 (Stk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611 Hamartin
Other DBs
NCBI-GeneID: 110284093
NCBI-ProteinID: XP_021005378
Ensembl: MGP_CAROLIEiJ_G0024629
UniProt: A0A6P5NWV2
LinkDB
Position
2
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSGGANTMIEHGDT
LPSQLGTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKNVSGSLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEMEEIRQKYRSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagaccgtgcagctgaggaacccaccgcgcaggcagctgaaaaagttggatgaagat
agtttaaccaagcagccagaggaagtgtttgatgttttagagaagcttggagaggggtct
tatggcagtgtgtacaaggctattcataaagagactggccagatcgttgcaatcaagcaa
gtgcccgtggaatcggacctgcaggagataatcaaggaaatctccatcatgcagcagtgc
gacagccctcatgtagtcaaatattatggcagctactttaagaacacagacctgtggatt
gttatggagtactgtggggctggttctgtatctgatatcattcggctgcgaaacaagacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggactagaatacctt
cattttatgagaaaaatacaccgagatatcaaggcgggaaatattttgctaaacacagaa
ggccatgccaagcttgcagactttggagttgcaggtcaacttacagataccatggcaaag
aggaatacagtaatagggacaccattttggatggctcctgaagttattcaggaaattggg
tacaactgtgtggcagacatctggtctctgggaataactgccatagaaatggctgaagga
aagcccccatatgctgatatccatccaatgagggcaatattcatgattcctacaaaccct
cctcccacattccgtaagccagagctgtggtcagacaacttcatggattttgtgaagcag
tgtctggtaaaaagcccggagcagagagccacagccactcagctcctacagcacccgttt
gttaagagtgccaaaggagtgtcaatattgcgagacttaattaacgaagccatggatgtg
aaactgaagcgccaggaagcccagcagcgggaagtggaccaggacgacgaggagaactca
gaggaggatgaaatggattctggcacgatggttcgagctgccggtgatgagatgggcact
gtccgagtagccagcacgatgagcggaggagccaatactatgattgagcacggtgacacg
ttgccgtcccagctgggcaccatggtgatcaacacggaggatgaggaagaggaaggaacc
atgaaaagaagagatgagaccatgcagcctgcaaaaccgtctttccttgaatactttgaa
caaaaagaaaaggaaaatcagatcaacagctttggcaagaatgtatctggctctctgaag
aattcttctgattggaaaatccctcaggatggagactatgagtttctcaagagctggact
gtggaggaccttcagaagaggctcttggccctcgaccccatgatggaacaggaaatggaa
gagatccggcagaaataccggtccaagcggcagccaatcctggatgccattgaagccaag
aagaggaggcaacagaacttctga

DBGET integrated database retrieval system