KEGG   Mus caroli (Ryukyu mouse): 110284110
Entry
110284110         CDS       T05910                                 

Gene name
Tnf
Definition
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01523  Antifolate resistance
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04061  Viral protein interaction with cytokine and cytokine receptor
mcal04064  NF-kappa B signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04150  mTOR signaling pathway
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04350  TGF-beta signaling pathway
mcal04380  Osteoclast differentiation
mcal04612  Antigen processing and presentation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04650  Natural killer cell mediated cytotoxicity
mcal04657  IL-17 signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04940  Type I diabetes mellitus
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05134  Legionellosis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05144  Malaria
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05310  Asthma
mcal05321  Inflammatory bowel disease
mcal05322  Systemic lupus erythematosus
mcal05323  Rheumatoid arthritis
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05410  Hypertrophic cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284110 (Tnf)
   04350 TGF-beta signaling pathway
    110284110 (Tnf)
   04064 NF-kappa B signaling pathway
    110284110 (Tnf)
   04668 TNF signaling pathway
    110284110 (Tnf)
   04071 Sphingolipid signaling pathway
    110284110 (Tnf)
   04150 mTOR signaling pathway
    110284110 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110284110 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110284110 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110284110 (Tnf)
   04217 Necroptosis
    110284110 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110284110 (Tnf)
   04620 Toll-like receptor signaling pathway
    110284110 (Tnf)
   04621 NOD-like receptor signaling pathway
    110284110 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    110284110 (Tnf)
   04625 C-type lectin receptor signaling pathway
    110284110 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    110284110 (Tnf)
   04612 Antigen processing and presentation
    110284110 (Tnf)
   04660 T cell receptor signaling pathway
    110284110 (Tnf)
   04657 IL-17 signaling pathway
    110284110 (Tnf)
   04664 Fc epsilon RI signaling pathway
    110284110 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110284110 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110284110 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110284110 (Tnf)
  09163 Immune disease
   05310 Asthma
    110284110 (Tnf)
   05322 Systemic lupus erythematosus
    110284110 (Tnf)
   05323 Rheumatoid arthritis
    110284110 (Tnf)
   05321 Inflammatory bowel disease
    110284110 (Tnf)
   05330 Allograft rejection
    110284110 (Tnf)
   05332 Graft-versus-host disease
    110284110 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284110 (Tnf)
   05014 Amyotrophic lateral sclerosis
    110284110 (Tnf)
   05020 Prion disease
    110284110 (Tnf)
   05022 Pathways of neurodegeneration - multiple diseases
    110284110 (Tnf)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110284110 (Tnf)
   05410 Hypertrophic cardiomyopathy
    110284110 (Tnf)
   05414 Dilated cardiomyopathy
    110284110 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110284110 (Tnf)
   04940 Type I diabetes mellitus
    110284110 (Tnf)
   04932 Non-alcoholic fatty liver disease
    110284110 (Tnf)
   04931 Insulin resistance
    110284110 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110284110 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110284110 (Tnf)
   05135 Yersinia infection
    110284110 (Tnf)
   05133 Pertussis
    110284110 (Tnf)
   05134 Legionellosis
    110284110 (Tnf)
   05152 Tuberculosis
    110284110 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110284110 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    110284110 (Tnf)
   05161 Hepatitis B
    110284110 (Tnf)
   05160 Hepatitis C
    110284110 (Tnf)
   05171 Coronavirus disease - COVID-19
    110284110 (Tnf)
   05164 Influenza A
    110284110 (Tnf)
   05168 Herpes simplex virus 1 infection
    110284110 (Tnf)
   05163 Human cytomegalovirus infection
    110284110 (Tnf)
   05169 Epstein-Barr virus infection
    110284110 (Tnf)
   05165 Human papillomavirus infection
    110284110 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110284110 (Tnf)
   05144 Malaria
    110284110 (Tnf)
   05145 Toxoplasmosis
    110284110 (Tnf)
   05140 Leishmaniasis
    110284110 (Tnf)
   05142 Chagas disease
    110284110 (Tnf)
   05143 African trypanosomiasis
    110284110 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110284110 (Tnf)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Tumor necrosis fators
   110284110 (Tnf)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Cytokines
   110284110 (Tnf)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 110284110
NCBI-ProteinID: XP_021005394
Ensembl: MGP_CAROLIEiJ_G0021514
UniProt: A0A6P5NRJ1
LinkDB
Position
17
AA seq 235 aa
MSTESMIRDVELAEEALPKKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVKEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLVYSQVLFTGQGCPDYVLLTHTVSRFAIAYQEKVNLLSAIKSPCP
KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPEYLDFAESGQVYFGVIAL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagcacagaaagcatgatccgagacgtggaactggcagaagaggcactcccaaaaaag
atggggggcttccagaactccaggcggtgcctgtgtctcagcctcttctcattcctgctt
gtggcaggggccaccacgctcttctgtctactgaacttcggggtgatcggtccccaaagg
gatgagaagttcccaaatggcctccctctcatcagttctatggcccagaccctcacactc
agatcatcttctcaaaattcgagtgacaagcctgtagcccacgtcgtagcaaaccaccaa
gtgaaggagcagctggagtggctgagccagcgcgccaacgccctcctggccaacggcatg
gatctcaaagacaatcaactagtggtgccagccgatgggttgtaccttgtctactcccag
gttctcttcacgggacaaggctgccccgactatgtgctcctcacccacaccgtcagccga
tttgctatcgcataccaggagaaagtcaacctcctctctgccatcaagagcccctgcccc
aaggacacccctgagggggctgagctcaaaccctggtatgagcccatatacctgggagga
gtcttccaactggagaagggggaccaactcagcgctgaggtcaatctgcccgagtactta
gactttgccgagtctgggcaggtctactttggagtcattgctctgtga

DBGET integrated database retrieval system