KEGG   Mus caroli (Ryukyu mouse): 110284117
Entry
110284117         CDS       T05910                                 

Gene name
Tbp
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03022  Basal transcription factors
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    110284117 (Tbp)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110284117 (Tbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110284117 (Tbp)
   05017 Spinocerebellar ataxia
    110284117 (Tbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110284117 (Tbp)
   05165 Human papillomavirus infection
    110284117 (Tbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110284117 (Tbp)
   03021 Transcription machinery [BR:mcal03021]
    110284117 (Tbp)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    110284117 (Tbp)
Transcription machinery [BR:mcal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     110284117 (Tbp)
  RNA polymerase III system
    TFIIIB
     110284117 (Tbp)
  RNA polymerase I system
    SL1/TIF-1B
     110284117 (Tbp)
SSDB
Motif
Pfam: TBP EPL1 Spt20 TFIIA Cnd2 Presenilin Tombus_movement
Other DBs
NCBI-GeneID: 110284117
NCBI-ProteinID: XP_021005408
Ensembl: MGP_CAROLIEiJ_G0021096
UniProt: A0A6P5NRK1
LinkDB
Position
17
AA seq 318 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPS
PMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVI
MRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGS
CDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEI
YEAFENIYPILKGFRKTT
NT seq 957 nt   +upstreamnt  +downstreamnt
atggaccagaacaacagccttccaccttatgctcagggcttggcctccccacagggcgcc
atgactcctggaattcccatcttcagtccaatgatgccttacggcacaggacttactcca
cagcctattcagaacaccaacagtctctctattttggaagagcaacaaagacagcagcag
cagcagcaacagcagcagcagcagcaacaacagcaggcagtagcaactgcagcagcctcc
gtacagcaatcaacatctcagcaacccacacagggcgcctcaggccagaccccacaactc
ttccattctcaaactctgaccactgcaccgttgccaggcaccacccccttgtacccttca
ccaatgactcctatgacccctatcactcctgccacaccagcttctgagagctctgggatt
gtaccgcagcttcaaaatattgtatccaccgtgaatcttggctgtaaacttgacctaaag
accattgcacttcgtgcaagaaatgctgaatataatcccaagcgatttgctgcagtcatc
atgagaataagagagccacggacaactgcgttgattttcagttctggaaaaatggtgtgc
acgggagccaagagtgaagaacaatccagactagcagcaagaaaatatgctagagttgtg
cagaagttgggcttcccagctaagttcttagacttcaagatccagaacatggtggggagc
tgtgatgtgaagttccccataaggctggaaggccttgtgttgacccaccagcagttcagt
agctatgagccagaattatttcctggattaatctacaggatgatcaaacccagaattgtt
ctccttatttttgtttctggaaaagttgtattaacaggtgctaaagttagagcagagatt
tatgaagcatttgaaaacatctaccccatcttaaagggattcaggaagaccacatag

KEGG   Mus caroli (Ryukyu mouse): 110289978
Entry
110289978         CDS       T05910                                 

Gene name
Tbpl2
Definition
(RefSeq) TATA box-binding protein-like protein 2 isoform X1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03022  Basal transcription factors
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    110289978 (Tbpl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110289978 (Tbpl2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110289978 (Tbpl2)
   05017 Spinocerebellar ataxia
    110289978 (Tbpl2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110289978 (Tbpl2)
   05165 Human papillomavirus infection
    110289978 (Tbpl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110289978 (Tbpl2)
   03021 Transcription machinery [BR:mcal03021]
    110289978 (Tbpl2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    110289978 (Tbpl2)
Transcription machinery [BR:mcal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     110289978 (Tbpl2)
  RNA polymerase III system
    TFIIIB
     110289978 (Tbpl2)
  RNA polymerase I system
    SL1/TIF-1B
     110289978 (Tbpl2)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 110289978
NCBI-ProteinID: XP_021012080
Ensembl: MGP_CAROLIEiJ_G0023231
UniProt: A0A6P5PGC1
LinkDB
Position
2
AA seq 350 aa
MVGSLIMEEDIYLDLFLDPYTIQDDFPPAMSQLLSPGVPLDMHSLPSNPETVFHPHLGGI
KKASTDFSSVDLSFLPDELTQENRDQTVSGNKLASEESCRTRDRQSQLKLPDEHGSELNL
NSNTSPDTQSCLCFDDADSNQPSPETPNSNALPVALISSMMPMNPVPGFSGIVPQLQNVV
STANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEE
SRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSSYEPELF
PGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFKKV
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtaggctctctcatcatggaggaggacatatacctggacctcttcctggatccttat
accatccaggatgactttcctccagctatgtctcaactgctcagcccaggagtgccttta
gacatgcactcacttccatctaatccagagactgtgtttcatccacatcttggtggcatc
aaaaaggcatccactgacttttcatctgtggatctaagcttcttaccagatgaacttacc
caagaaaatagagaccaaactgtcagtggaaacaagctggcaagtgaggaaagctgtagg
actcgagatcgacaaagtcagttgaagttgcccgatgaacatggcagtgagctgaacttg
aatagcaacacttcaccagatacccagtcatgtctgtgctttgatgatgctgactccaac
cagccctctccagaaacaccaaactccaatgccttacctgtggcattgatatcatccatg
atgccaatgaaccctgttccaggattttctggaattgtgcctcaattacagaatgtagtt
tctactgcaaatctggcctgtaaattggacctgagaaaaatagccctgaatgccaaaaac
acagaatataacccaaagaggtttgctgcagtaataatgaggatccgagagccaaggaca
acagccctcatatttagctctgggaaagtggtctgtacaggagccaaaagtgaagaggag
tctcggctggcagcgagaaagtatgctcgtgtggtgcagaagctcgggttccccgtcaga
ttcttcaattttaaaattcagaacatggttggaagctgtgatgtgaaatttcccatcagg
ctggagattttggcactaacccatcggcagttcagtagcagttatgaacctgaacttttc
cctggccttatttataagatggtaaaaccacaggttgtgttgctaatctttgcatctgga
aaagttgtgttaacaggtgccaaagagcgttctgagatctatgaagcatttgaaaacatg
tatcctattctagaaagttttaagaaagtctga

KEGG   Mus caroli (Ryukyu mouse): 110303300
Entry
110303300         CDS       T05910                                 

Gene name
Tbpl1
Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03022  Basal transcription factors
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    110303300 (Tbpl1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110303300 (Tbpl1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110303300 (Tbpl1)
   05017 Spinocerebellar ataxia
    110303300 (Tbpl1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110303300 (Tbpl1)
   05165 Human papillomavirus infection
    110303300 (Tbpl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303300 (Tbpl1)
   03021 Transcription machinery [BR:mcal03021]
    110303300 (Tbpl1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    110303300 (Tbpl1)
Transcription machinery [BR:mcal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     110303300 (Tbpl1)
  RNA polymerase III system
    TFIIIB
     110303300 (Tbpl1)
  RNA polymerase I system
    SL1/TIF-1B
     110303300 (Tbpl1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 110303300
NCBI-ProteinID: XP_021030034
Ensembl: MGP_CAROLIEiJ_G0015168
UniProt: A0A6P7RFV6
LinkDB
Position
10
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcattggacattttaattacaaatgtagtctgtgttttt
agaacacgatgccatttgaacttaaggaagattgctttggagggagcaaatgtaatttat
aagcgtgatgttgggaaagtattaatgaagcttagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgtttagcccgtagtctgcagaaactaggttttcaggtcatcttcacagacttt
aaggtggtgaatgttttggcagtgtgtaacatgccctttgagatccgtttgccagaattt
acaaagaacaatagacctcatgccagctatgaacctgaacttcatcctgccgtgtgctat
cggataaagtctctaagagctacattacagatattttcaacaggaagtatcacagtgaca
gggcccaatgtaaaggctgtggcgactgccgtggaacagatctacccgttcgtgtttgaa
agcaggaaggagattttataa

DBGET integrated database retrieval system