KEGG   Mus caroli (Ryukyu mouse): 110284320
Entry
110284320         CDS       T05910                                 

Gene name
Srd5a2
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00140  Steroid hormone biosynthesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110284320 (Srd5a2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    110284320 (Srd5a2)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     110284320 (Srd5a2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 110284320
NCBI-ProteinID: XP_021005696
Ensembl: MGP_CAROLIEiJ_G0021872
UniProt: A0A6P5P0T9
LinkDB
Position
17
AA seq 254 aa
MPIVCHQVPVLAGSATLATMGTLILCCGKPASYGKHSKSVSPGVPLLPARLAWFLQELPS
FVVSVGMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATAFCI
GNGLLQAYYLVYCAEYPEEWYTDMRFSVGVFLFILGMGINIHSDCMLRQLRKPGEVIYRI
PRGGLFTYVSGANFLGEIIEWMGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccgattgtgtgccatcaggtcccggtgctggcaggtagcgccacattggccaccatg
gggaccctgatcctgtgctgtgggaaacccgccagttacgggaaacacagcaagagtgtg
tcgccgggagttcccctcctgcccgcacgcctagcctggttcctgcaggagctgccttcc
tttgtggtgtcagtagggatgctcgcttggcagccgcgctccctctttggacctccgggg
aatgtgctgctgggtctcttctccgcgcattacttccacaggacatttatttactcattg
ctcaccagaggaaggcctttatcagcggtgatctttctgaaagccactgccttctgcata
gggaacggactcctgcaagcctactacctggtttattgcgcggaataccccgaggagtgg
tacacagacatgcggtttagcgtcggtgtcttcctctttattctggggatggggatcaac
atccacagtgactgcatgctgcgccagctcaggaagcccggagaggtcatctacaggatc
ccacgaggtggcttgtttacatatgtgtctggagccaatttcctgggcgagataattgaa
tggatgggctacgctttggccacttggtctgttccagcctttgcttttgcatttttcaca
ctttgtttcctggggatgcaagctttttaccaccacaggttctacctcaagatgtttaag
gattaccccaaatctaggaaagccctcattccattcatcttttaa

DBGET integrated database retrieval system