KEGG   Mus caroli (Ryukyu mouse): 110284330
Entry
110284330         CDS       T05910                                 

Gene name
Msh6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03430  Mismatch repair
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    110284330 (Msh6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284330 (Msh6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284330 (Msh6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110284330 (Msh6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110284330 (Msh6)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     110284330 (Msh6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 110284330
NCBI-ProteinID: XP_021005711
Ensembl: MGP_CAROLIEiJ_G0021951
UniProt: A0A6P5NUX5
LinkDB
Position
17
AA seq 1360 aa
MSRQSTLYSFFPKSPALGDTKKAAAEASRQGAAASGASASRGGDAAWSEAEPGSRSAAVS
APSPEAKDLNGGLRRASSSAQAVPPSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
RKKGKSVRVHVQFFDDSPTRGWVSKRMLKPYTGSKAKEAQKGGHFYSSKSEILRAMQRAD
EALSKDTAERLQLAVCDEPSEPEEEEEETEVREAYLSDKSEEDNYNGSEEEEAQPSVQGP
RRSSRQVKKRRVISDSESDVGGSDVEFKPDTRQEGSSDDASSGVGDSDSEDLGTFGKGAP
KRKRAMVAQGGLRRKSLKKETGSAKRATRILSETKSTLSAFSAPQNSESQTHVSGGGNDS
SGPTIWYHETLEWLKPEKRRDEHRRRPDHPEFNPTTLYVPEDFLNSCTPGMRKWWQFKSQ
NFDLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKGYK
VARVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLDGDPSENYSRYL
LSLKEKEEETSGHTRVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHHPPVQILFEKG
NLSTETKTVLKSSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFTGDGGSSTVLPLVLKG
MTSESDSVGLTPGEESELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVSTVK
PGAVFTKASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAP
LCSPSAISDRLDAVEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSR
AIMYEETTYSKKKIIDFLSALEGFKVMCKVSGLLEEVAGGFTSKTLKQVVTLQTKSPKGR
FPDLTAELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSR
IGCKSIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINA
EERRDTSLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSQGGDGPMCRPEVLL
PGEDTHPFLEFKGSRHPCITKTFFGDDFIPNDILIGCEEEAEERGKAYCVLVTGPNMGGK
STLIRQAGLLAVMAQLGCYVPAEKCRLTPVDRVFTRLGASDRIMAGESTFFVELSETASI
LRHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKSV
CVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHKKA
REFERMNQSLQLFREVCLATEKPTINGEAIHRLLALINGL
NT seq 4083 nt   +upstreamnt  +downstreamnt
atgtcccgacaaagcaccctgtacagcttcttccccaagtccccggcactcggcgacacc
aagaaggccgcggccgaggcctcacgccaaggtgccgctgcctctggagcctccgcttcc
cgcggcggggatgcggcctggagcgaggctgaaccggggtcccggtccgcggcggtatcc
gccccgtcgccggaggcaaaggatctcaacggagggctgcggagggcctcctcctccgcg
caggccgtgcctcccagttcttgtgacttttcaccaggcgacttggtttgggctaagatg
gaaggttacccctggtggccttgcctagtttataatcatccctttgatggaacgttcatc
cggaagaaagggaaatctgtccgtgttcacgtacagttctttgacgacagcccaacaagg
ggctgggttagcaaaaggatgttaaagccatatacaggttcaaaggcaaaggaagcccaa
aagggaggtcatttctacagttcaaagtctgagatactcagagcaatgcaacgtgcagac
gaggccttaagtaaagacacggctgagaggctgcagctggcagtgtgtgatgagccttca
gagccggaggaggaggaggaggagacagaggtgcgtgaggcttatttatctgataagagt
gaagaggataattacaacgggagtgaagaagaagaagcacagcccagtgttcaggggcct
aggcgaagcagccggcaagtcaagaagcgacgggtcatctcagactcggagagtgacgtt
ggtggctctgatgtagaattcaagccagacactaggcaggaaggaagcagtgatgacgca
agcagtggagttggggacagcgatagtgaggacctgggcaccttcggcaaaggcgctcca
aagcggaagagagccatggttgctcagggtggacttagaaggaaaagtctgaagaaggaa
acaggctcagccaaacgagcaactcgcattctgtcagaaaccaagagtaccttgagtgct
ttttctgcccctcaaaattctgaatcccagacccacgtcagtggaggaggtaacgacagt
agtggacccactatttggtatcacgaaactttagaatggcttaagccagaaaaaagaaga
gatgagcacaggagacgccccgatcaccctgaatttaatcccaccacactgtatgtgcct
gaagacttcctcaattcttgtactccagggatgaggaagtggtggcagttcaagtctcag
aactttgatcttgtcatcttttataaggtggggaagttttatgaattgtatcacatggat
gctgttattggagtcagtgagctggggctgatattcatgaagggcaactgggcccattct
ggttttccagagattgcatttggccgattctcggattccttggtgcagaagggctataag
gtagcacgggtggaacagaccgagactccagaaatgatggaggcacgatgccggaagatg
gctcacgtgtccaagtttgatagagtggtgagacgggagatttgcaggatcattactaag
ggcacgcagacctacagtgtgctggatggcgatccctctgagaactacagtaggtatctt
cttagcctcaaggagaaggaggaagagacttctggtcacactcgtgtgtatggtgtttgc
tttgtggacacgtcactgggcaagtttttcataggccagttttcggatgaccgccactgt
tccagatttaggactctagtggcacaccatcctccagtacaaattttgtttgagaaagga
aatctctcaacagagaccaaaactgtcctaaagagttcactgtcatcttgtcttcaggaa
ggtctcataccaggttcccaattttgggatgccactaagactttgcgaacactccttgaa
ggagggtacttcactggagatggaggcagtagtacagtgctgcctctggtccttaaagga
atgacctcggagtcagattctgtagggttgaccccaggcgaggagagtgaattggcgctc
tctgctctaggcggtattgttttctacctcaaaaaatgcctgattgatcaggagcttctg
tcaatggctaattttgaagagtatttccctttggattctgacacagtcagcacagtaaaa
cctggtgctgtctttactaaagccagtcagcgaatggtgctagacgcagtgacgttaaac
aacctggagattttcctgaatgggacaaatggctctactgaagggaccctgctagagaga
ctggatacttgccataccccctttggcaagcggctcttaaaacagtggctttgtgccccc
ctctgcagcccttctgccatcagtgaccgtttagatgctgtggaagatctgatggccgtg
cctgacaaggtcactgaagttgcagacctcttaaagaagctgccagatcttgagcggctg
ctgagtaagattcacaatgttgggtctcccctaaagagccagaaccatccagacagcagg
gctataatgtacgaggaaacgacatacagcaaaaagaagatcattgattttctctctgct
ctagaaggattcaaagtaatgtgtaaagtctcggggcttctggaggaggttgcgggtggt
tttacgtctaaaaccctcaagcaggttgttactctacagacaaaaagtcctaaaggccgc
tttcctgatctgactgcagaactgaaccgatgggacacagcctttgaccatgagaaagct
cgaaagacagggctcattactccaaaagcagggtttgactccgattatgaccaagcactt
gctgatataagagagaatgaacagagcctcctggagtacttagacaaacagcgtagtcgg
atcggctgtaagagcatagtctactggggaatcggtaggaaccgttaccagttagagatt
ccagagaattttgctacccgtaatctacctgaagaatatgagttgaaatctactaaaaaa
ggctgtaaacgatactggaccaaaacaattgagaagaaattagctaatcttataaatgct
gaagagcgcagggacacatctttaaaggactgcatgcggcgcctgttctataacttcgat
aaaaactacaaggactggcaggctgctgtagagtgcattgcagtgttggatgtcttactg
tgcctggctaactacagtcaaggaggagatggtcctatgtgtcgcccagaagttctgtta
cccggagaagacacacatcccttcttagagtttaaagggtcacgacatccctgcattaca
aagacgttttttggagacgattttattcctaacgacattctaataggctgcgaggaagaa
gcagaagaacgtggcaaagcctattgtgtgcttgtgactggaccaaatatggggggcaaa
tctacactcataagacaggctggtctgttggctgtaatggcccagctgggttgttacgta
cctgctgagaagtgcaggctcacaccagttgacagagtgttcactaggcttggtgcctca
gacagaatcatggcaggggaaagtacattttttgttgagttgagcgaaactgctagcata
cttaggcatgcaacagcacattctttggtacttgtggatgaattaggaagaggcaccgca
acttttgatgggacagcgatagccaatgctgttgttaaagaacttgctgaaaccataaag
tgtcgaacactgttttctacacactatcattcattagtagaagattactctaaaagtgtg
tgtgtacgcctaggacatatggcatgcatggtagaaaatgaatgtgaggaccccagccag
gagactattactttcctctataaattcatcaagggagcttgtcctaagagctacggcttt
aatgcagcacggcttgcgaatcttccggaggaggttattcagaagggacacaaaaaagca
agagaatttgagaggatgaatcagtcattacaactgtttcgggaagtttgtctggctact
gaaaagccgactataaacggtgaagctatccataggttgctggccttgattaacggattg
tag

DBGET integrated database retrieval system