KEGG   Mus caroli (Ryukyu mouse): 110284338
Entry
110284338         CDS       T05910                                 

Gene name
Tsc2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04072  Phospholipase D signaling pathway
mcal04115  p53 signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    110284338 (Tsc2)
   04151 PI3K-Akt signaling pathway
    110284338 (Tsc2)
   04152 AMPK signaling pathway
    110284338 (Tsc2)
   04150 mTOR signaling pathway
    110284338 (Tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110284338 (Tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    110284338 (Tsc2)
   04218 Cellular senescence
    110284338 (Tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110284338 (Tsc2)
   04919 Thyroid hormone signaling pathway
    110284338 (Tsc2)
  09149 Aging
   04211 Longevity regulating pathway
    110284338 (Tsc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110284338 (Tsc2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110284338 (Tsc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110284338 (Tsc2)
   05163 Human cytomegalovirus infection
    110284338 (Tsc2)
   05165 Human papillomavirus infection
    110284338 (Tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110284338 (Tsc2)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110284338 (Tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 110284338
NCBI-ProteinID: XP_021005716
UniProt: A0A6P7QNL5
LinkDB
Position
17
AA seq 1809 aa
MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRM
IGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
ITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDI
LLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPE
SSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPPELEERDLAVHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKH
GYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCTELDRASEKKAS
GPLSPPTGPPSPVPMGPAVRLGHLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYK
VLIFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARAPKQGLNNS
PPVKEFKESCAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
VLDTSAPYPPSGPASLGPQTAAAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAGT
AKPPTLPRSNTVASFSSLYQPSCQGQLHRSVSWADSAMVLEEGSLGETQVPVEPPELEDF
EAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQP
SQPLSKSSSSPELQTLQDILGDLGDKTDIGRLSPEAKVRSQSGILDGEAATWSAAGEESR
ITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGIN
PSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSE
LAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAV
FHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHVIITPLDY
KCNLLTLQCRKDMEGLVDTSVAKIVSDRNLSFVARQMALHANMASQVHHSRSNPTDIYPS
KWIARLRHIKRLRQRIREEVHYSNPSLPLMHPPAHTKVPAQAPTEATPTYETGQRKRLIS
SVDDFTEFV
NT seq 5430 nt   +upstreamnt  +downstreamnt
atggccaaaccaacaagcaaagattcaggcttgaaggagaagttcaagatactgttggga
ttgggaacatcgaggccaaatcccaggtgtgcagaaggcaaacagactgagtttatcatc
acatcggaaatcttgagagaactgagtggtgaatgcggcctcaacaatcgcatccgaatg
atagggcagatctgtgatgtggcgaaaactaagaagcttgaggagcatgccgtggaggca
ctttggaaggctgtctcagacttgctacagccagagcggccaccagaggcccgacatgca
gttctcaccttattgaaggccattgtacagggacagggtgatcgtttgggagttctcaga
gccctcttcttcaaagtgatcaaggattacccctccaatgaagacctccatgaaaggcta
gaagtttttaaggccctcacagacaatgggaggcacattacctatttggaagaagagctg
gcagagtttgtcctgcagtggatggatgttggcttgtcctcagaattccttctggtactt
gtcaacctggtcaagttcaacagctgttaccttgacgaatacattgcatcaatggttcac
atgatttgtctgctatgcatccggacagtgtcctctgtggacattgaggtgtccttgcaa
gtgctggatgctgtggtctgctacaactgcctaccagccgagagcctgcctctgttcatt
atcaccctgtgccgcaccatcaatgtcaaggagctgtgtgagccttgctggaagctgatg
cgtaaccttctgggcacccatctgggccacagcgccatctataacatgtgccgcatcatg
gaggacagatcctacatggaagacgccccactgctgagaggagctgtgttctttgtaggg
atggcactctggggagctcaccggctctattctctcaagaactcccccacatctgtgctg
ccgtctttttatgaggctatgacctgtcccaatgaggtggtgtcatatgagattgttctc
tccataacaagactcatcaagaaatataggaaggagctccaggctgtgacatgggatatt
ctgctagacatcattgaacgactacttcagcaactccagaacctggacagcccagaactc
aagaccatcgtccatgacctgctgaccactgtggaggagctatgtgaccagaacgagttc
catggctcgcaggaaagatactatgaactggtggagagctatgcagaccagagacctgaa
tcctctctcttaaacttgatatcctacagagcccagtccatccaccccgccaaggatggc
tggatccagaacttgcagttgctgatggagaggttcttcaggaatgagtgccgcagcgcc
gtgcgcatcaaggtgttggatgttctgtccttcgtgctgctgatcaacaggcagttctat
gaggaggagctgattaactcggtggtcatctcacagctctcccacattcccgaggataaa
gaccatcaggtccgaaagctggctactcagctgctggtggacctggcagagggctgccac
acccaccacttcaacagtctgctggacatcattgaaaaggtgatggcgcgctcactgtct
ccacccccggagctggaagaaagggacctggctgtgcactcggcctccctggaggatgtg
aagaccgcggtcctggggctcctggtcatccttcagaccaagctctataccttgcctgcc
agccacgccactcgagtgtatgagagcctcattagtcacatccagctccattacaagcac
ggctactccctgcccattgctagcagcatccggctgcaggcctttgacttcctgctgcta
ctgcgggccgactcgctgcatcgactgggcctgcccaacaaggatggggtcgtgagattc
agcccttactgcctctgtgactgcacggaactggatagagcctcagagaagaaagccagt
gggcccctttcacctccaactgggccccctagccctgtgccaatgggccctgctgtgcga
cttggccacctaccctactccctgctcttccgtgtcctgttgcagtgtttgaagcaggag
agcgactggaaggtgctgaagctggtgctcagcaggctgccggagtcactacgctacaaa
gtcctcatcttcacctccccctgcagtgtcgaccagctgtcttctgccctctgctccatg
ctttcagctccaaagacccttgagcggctccgaggcaccccagaaggcttctcaagaact
gacctgcacttggctgtggttcctgtgctaacagcattaatatcttatcacaactatttg
gacaagaccagacagcgtgagatggtgtactgcctggaacaaggccttatctaccgctgc
gccagccagtgcgtggtagccttggccatctgcagtgtggagatgcccgacatcatcatc
aaggcgcttcctgtcctggtggtgaagctcacacacatttctgccacagccagcatggcc
atcccgctcctggagttcctgtctactttggccaggctgccccacctctacaggaacttt
gctgcagagcagtatgccagcgtgtttgccatctccttgccatacaccaacccctccaag
ttcaaccagtacattgtgtgtctggctcaccatgtcatagccatgtggttcatcaggtgc
cgactgccctttcggaaggatttcgtcccttatatcactaagggtctgcgttccaatgtc
ctcctgtcttttgatgatacccctgagaaggacagtttcagagcacggagcaccagtctt
aatgagagacccaaaagtttgaggatagccagagcccccaaacaaggcctgaataactct
ccacctgtgaaagaattcaaagagagctgtgcagccgaggccttccggtgccgcagcatc
agtgtatctgaacatgtggtccgcagcagaatacagacatcccttaccagcgccagcctg
gggtctgcggatgagaactctatggcccaggctgatgacaacttgaagaatctccacttg
gagctcacagaaacatgtctggacatgatggcccgatatgtgttctccaatttcactgca
gtccccaagaggtcccctgtgggagagttcctcctggcagggggtaggaccaaaacctgg
ctggttggaaacaagcttgtcactgtgacaacaagtgtgggaaccggtacacggtcgctg
ctgggcctggactctggggacctgcagggtggctcagattcaagctctgatcctagcaca
catgtgaggcagacaaaggaagcaccggctaaactggagtcccaggctgggcagcaggtg
tcccgtggggcgcgggaccgggtccgctccatgtcggggggccatggccttcgagttggt
gtcctggatacttcagctccctatcccccaagtggccctgcttctctgggaccacagacg
gcggcagcagcgaagcccgagaagccccctgcaggagcccagcttccaacagcagagaag
acaaatctggcagcctatgtgcctttgttgacccagggctgggcagaaatcttggtccgc
agacccacaggaaacaccagctggctgatgagcttggagaacccgctcagccccttctcc
tcagacatcaacaacatgcccctgcaagagctgtccaatgcccttatggctgctgaacgt
ttcaaggagcaccgggacacggccctgtacaagtcattgtcagtgccagcggctggcacc
gccaagcctcctactctcccacgctctaatacagtggcttctttctcctccctgtaccag
cccagctgccaaggacagctgcacaggagcgtttcctgggcagactcggccatggtcctt
gaggagggaagtctaggagagactcaggtgccagtggagccccccgaattggaggatttc
gaggcggcattaggtacagacaggcactgccagcggcctgacacctacagccggtcatcc
tcagcatctagccaggaagaaaagtcccatttggaggagcttgctgcagggggtatcccc
attgagcgggccatctcctctgagggggctcggcctgccgtggacctctccttccaaccc
tcacagcctttgagcaagtctagctcttctccggagttgcagaccttacaggacatcctt
ggagacctaggggacaagactgatattggacggctgagtcctgaggctaaggtccggtcc
cagtcagggatcctggatggggaagcagctacctggtcagctgcaggtgaagagagccgt
atcacagtcccacctgaaggtcctctgccttccagttctccccgctcccccagtggcctc
cggccccgaggctataccatctctgattctgctccatcacgaaggggaaagagggtagaa
agggataacttcaagagcagagctgcggcctccagtgctgagaaggtgccaggcatcaac
cctagctttgtgttcctacagctctaccattcgcccttttttggtgatgagtccaataag
cccatcctgttgcccaatgagtcctttgaacggtcagtacagctgcttgaccagattcca
tcctatgacactcacaagattgctgtcctgtatgtgggagaaggccagagcagcagtgag
ctggccatcctgtcaaatgagcatggctcttacaggtacacggagtttctcacaggcctg
ggtcgccttattgagctcaaggactgccaaccagacaaggtgtacttaggtggactggat
gtatgtggcgaggatggacagttcacctactgctggcatgatgacatcatgcaagctgtt
ttccacattgccaccctgatgcccaccaaggatgtggacaaacaccgctgtgacaaaaaa
cggcacctgggcaatgactttgtttctatcatctacaatgattctggtgaggacttcaag
ctgggcaccattaagggccagttcaactttgtccatgtgatcatcacaccgctggactac
aagtgcaacctattgaccctgcagtgcaggaaagacatggagggcctcgtggacaccagc
gtggccaagattgtgtctgaccgtaacctgtcctttgtggcccgacagatggccctgcat
gcaaatatggcctcacaggtacaccacagccgatccaaccccactgacatctatccctcc
aagtggatcgcaagacttcgccacattaagcgtctccgccagaggatccgtgaagaggtg
cactattcaaacccaagcttgcctctgatgcaccctccagcccacaccaaagtcccagct
caagcccctactgaggctacacccacctatgaaacaggccagcggaagcgcctcatttcc
tccgtggatgacttcacagagtttgtgtga

DBGET integrated database retrieval system