KEGG   Mus caroli (Ryukyu mouse): 110284386
Entry
110284386         CDS       T05910                                 

Gene name
Eml4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05223  Non-small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284386 (Eml4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110284386 (Eml4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110284386 (Eml4)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     110284386 (Eml4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7 SlyX Ge1_WD40
Other DBs
NCBI-GeneID: 110284386
NCBI-ProteinID: XP_021005785
Ensembl: MGP_CAROLIEiJ_G0021916
UniProt: A0A6P5NSF5
LinkDB
Position
17
AA seq 988 aa
MDGFAGSLDDSISAASTSDVQDRLAALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSMPSKGQPSLREAISMSCITNGSGISRKQNHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEDSHSNDQSPQIRASPSPQPSSQPLQINRQTPESKSSAPIKSIKRPPTAEK
SHNSWENSDDSRNKLMKTVSTSKLISKVIKNTDKHKDVIVNQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAVHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLTTLHVIGLGTFERGVGCLDFSKADSGIHLCVIDDSNEHMLTVWDWQKKSKIAEIKTTN
EVVLAVEFHPTDANIIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFIQCLAFLGNGD
VLTGDSGGVMLIWSKTMVEPPPGKGPKGVYQINRQIKAHDGSVFTLCQMRNGMLLTGGGK
DRKIILWDHDLNLEREIEVPDQYGTIRAVAEGRAEQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYTVLENGR
KYSRYGKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPVPQNEVITDASVTKTPASSS
ETARPSNSPPLPPSLPLTGTAEEESRMGSSSTLVENSLEQITEPSEEQSEWGREDLGVLI
DEEPASELGEKQGAPELPEEDRGTTPLC
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgcagcaagtacctctgacgtt
caagaccgcctcgcagctcttgagtcacgagttcaacaacaagaagatgaaatcactgtg
ctaaaggcagcattggctgatgttttgaggcgtcttgcaatctctgaagatcatgtagcc
tcagtgaaaaagtccatgccaagtaaaggccaaccaagccttcgagaagctatttctatg
tcctgtatcaccaatggaagtggtataagcagaaaacaaaatcataccagctctgtatca
atagcaagaaaagaaactctttcttcggctgctaaaagtggtacagaaaaaaagaaagaa
aagccacaaggacagagagaaaaaaaagaggactctcattctaatgatcagagcccacaa
attcgagcgtcaccttctccccagccctcttcacagcctctccaaataaacagacaaact
ccagagagcaagagttctgctcccatcaaaagcataaaacgtccaccaacagctgaaaag
tcacataactcatgggaaaattcagatgatagtcgtaataaattaatgaaaacggtttca
acatcaaaactaatatcaaaggttataaaaaatacagacaaacataaagatgtcatcgtc
aatcaagcaaaaatgtcaacccgggaaaaaaacagccaagaaggagaatatattaaaatg
tttatgcgaggtcggccaattacaatgttcattccttcggatgttgacaactatgatgac
atcagaacagaactgcctccggagaagctcaaactggagtgggtatatggttatcgagga
aaggactgtagagcaaatgtatacctgcttcccacaggggagatagtttatttcatcgcc
tcagtggtagtcctgtttaattatgaggagaggactcagcgacactacctgggtcataca
gactgtgtgaaatgccttgctgtacatcctgacaagattagaatcgcaactggacagata
gccggagtagacaaagatggaaggcctctgcaaccccatgtcagggtgtgggattcagta
agtcttaccacactgcatgttattggacttggaacttttgagcgtggagtaggatgcctg
gatttttcaaaagcagattcaggtattcatttatgcgttattgatgactccaatgaacat
atgcttactgtatgggactggcagaaaaaatcaaaaatagcagaaataaagacaacaaac
gaagttgttttggctgtagaattccacccaacagatgcaaatataataataacatgtggt
aaatctcatatttttttctggacctggagtggcaactcactaacaagaaaacagggaatt
tttgggaaatatgaaaaaccaaaattcattcagtgtttggcattcttggggaatggagat
gttctcactggagactcgggtggagtcatgctgatctggagcaaaacgatggtagagccc
ccgcccgggaaaggacctaaaggtgtgtatcagatcaacagacaaatcaaagctcatgat
ggcagtgtgtttacactttgtcagatgagaaatgggatgctattaactggaggcggaaaa
gacagaaaaataattttgtgggatcatgatctgaaccttgaaagagaaatagaggttcct
gatcagtatggcaccattagagcagttgcagagggaagggcagaacagttcttagtaggc
acatcacgaaactttattttacggggaacgtttaatgatggcttccaaatagaagtccag
ggtcatacagatgaactctggggccttgcaacacatcccttcaaagatttgctcttgacg
tgtgctcaggacaggcaggtgtgcatgtggaactcagtggagcacaggctggagtggacc
aggcttgtggacgaaccaggacactgtgcagactttcatccaagcggtacagtggtagcc
attggaacgcactcaggcaggtggtttgttctggatgcagaaacaagagatctggtgtca
atccacacggatggcaatgagcagctgtctgtgatgcgctactcagtagatggtactctt
ctggctgtgggctctcatgacaactttatttacctctacacagtcttagaaaacggaaga
aaatacagcagatatggaaagtgcactggacattctagctacatcacacaccttgactgg
tccccagacaataagcatataatgtctaactcgggtgactacgagatactgtactgggac
attgaaaatggctgcaaactaatcaggaaccgatcagattgcaaggacatcgattggaca
acatatacctgtgtgctaggcttccaagtctttggagtctggccggaaggatctgatggg
acagacatcaacgcactggttcgatcccacaacagaagagtgatcgcagtggctgatgat
ttctgtaaagttcatctctttcagtacccctgctccaaagccaaggctcccagtcacaag
tacagtgcccacagcagccatgtgaccaacgtcagttttactcataatgacagtcaccta
atttcaactggtgggaaagatatgagcatcattcagtggaagcttgtggaaaagttacct
gtgcctcaaaacgaggtcataacagacgccagtgtgaccaaaacccctgcctcttcctct
gaaactgccaggccgtctaactctcctccactgcctccttccctaccattaactgggacg
gctgaagaggaaagcagaatgggcagctcctccacacttgtggagaacagcctggagcag
atcacagagcccagcgaggagcagagcgagtggggtagggaagaccttggtgtgctgatt
gatgaagagcctgctagtgagttaggtgagaaacagggagcacctgagctgcctgaggag
gatcgaggcacaacacccctatgctaa

KEGG   Mus caroli (Ryukyu mouse): 110312131
Entry
110312131         CDS       T05910                                 

Gene name
Alk
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05223  Non-small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312131 (Alk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110312131 (Alk)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110312131 (Alk)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110312131 (Alk)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   110312131 (Alk)
CD molecules [BR:mcal04090]
 Proteins
  110312131 (Alk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 110312131
NCBI-ProteinID: XP_021041338
Ensembl: MGP_CAROLIEiJ_G0021865
UniProt: A0A6P5R273
LinkDB
Position
17
AA seq 1621 aa
MGAVGFLWLLPPLLLAAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPQPRSPSEPEAGGLEARGSLALDCEPLLRLLGPLPGISWAEGASSPS
PESGPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEAAAVGILQFNLSELFS
WWILHGEGRLRIRLMPEKKASEVGREGRLSSAIRASQPRLLFQIFGTGHSSLESPSETPS
PPGSFMWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNHGNQSWSWRHVPSE
EASRMNLLDGPEAERSQEMPRGSFLLLNTSADSKHTILSPWMRSSSDHCTLAVSVHRHLQ
PSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYISSGNRSLSA
VDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDEGQLCSKLPA
GFYCNFENGFCGWTQSPLSPHVPRWQVRTLRDAHSQGHQGRALLLSTTDIPASEGVTVTS
ATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVATNEGLSLWQRT
VLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKMSLNSVPKSRNLF
EKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGS
EGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTLYILVG
QQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV
PLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSL
LEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGV
SFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAD
DGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSP
EYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVS
GMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILL
ELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCL
LTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFG
VLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNF
AIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQPAKQEEA
SAAPQPAALTAPGPLVKKPPGAGAGAGAGAGAGPVPRGAADRGHVNMAFSQPNPLPELHK
GPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAA
LLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTMLKSKNKVTQPG
P
NT seq 4866 nt   +upstreamnt  +downstreamnt
atgggagctgttgggttcctgtggctgctgcctccactgcttttggcagcagcctcgtac
tccggagctgcaaccgatcagcgcgcgggttccccagcctcagggccgcctctgcagccc
cgggagccgctcagttattcgcgcctgcagaggaagagtctggcagtggacttcgttgtg
ccctcgctcttccgcgtctatgcccgagacctgctgctgccgcagccacggtccccatcg
gagcccgaggctggcgggctggaggcgcggggatcactggccctggattgtgagcctctg
ctcaggctgctggggccactgcctggaatctcctgggcagagggagccagttctcctagt
cccgagtcgggtccgacgctgtccagggtgctgaagggaggctcggtgcgcaagctcagg
cgtgccaaacagctggtgctggagctgggagaggagacgattcttgaaggctgcattggt
cccccagaggaggcagcggctgtggggatactccagttcaatctcagcgagctgttcagc
tggtggattctccacggcgaagggcggctgaggatccgcctgatgcctgagaagaaggca
tcggaagtgggcagggagggaaggctatccagtgcgatccgagcctcccagccccgcctt
ctcttccagatcttcgggacgggacacagctccttggagtcaccctcagaaacgccttct
cctcctggtagcttcatgtggaatctgacctggacgatgaaagactccttccctttcctt
tcccaccgcagtcgatatggtctggagtgcagctttgacttcccatgtgagctggaatat
tctcctccccttcacaaccacgggaatcagagctggtcctggcgccatgtgccctccgag
gaggcctcgaggatgaacttgctggatgggccagaggcagagcgttctcaagagatgccc
agaggctccttcctcctcctgaacacctctgcagattccaagcacaccattctgagccca
tggatgaggagcagtagtgatcattgcacgctggctgtctcagtgcacagacatctacag
ccttccgggagatatgttgcccagctcctaccccacaacgaagctggaagagagattctt
ttggtgcccaccccggggaagcatggctggacagtgctgcaggggagagtcggacgacca
gcaaacccatttcgagtggctctggaatacatctccagtggcaaccggagcttgtcggcg
gtggatttctttgccctgaagaactgcagtgaagggacttccccaggctccaagatggca
ttgcagagttccttcacttgttggaatgggacagtcctccagctggggcaagcctgtgac
ttccaccaggactgtgcccaaggagaagatgagggccagctgtgcagtaaacttcctgct
ggattttactgtaactttgaaaatggcttctgtggctggacccaaagtccactctcaccc
catgtgccccggtggcaagtgaggaccctaagagatgcccattcccagggccaccaaggc
cgtgccctgttgctcagcaccactgacatccctgcttctgaaggtgtgacagtgaccagt
gccaccttccctgcaccaatgaaaaactctccttgtgagctccgcatgtcctggctcatc
cgcggggttttgaggggaaacgtatctctcgtgctggtggagaacaaaaccggaaaggag
caaagccggaccgtctggcatgtcgccaccaacgaaggcttaagcctgtggcagcgtaca
gtgctgtccctcctcgacgtgactgacaggttctggctgcagatagtcacatggtggggt
ccaggatccagggcaaccgtgggatttgacaacatttccatcagcctcgactgctacctc
accatcagtggagaggagaaaatgtccctgaattcagtacccaaatctagaaatctgttt
gagaaaaacccaaacaaggagtcaaaatcctgggcaaacatatcaggaccaactcccatc
ttcgaccctacagttcactggctgttcaccacgtgtggggccagtggacctcatggcccc
acgcaggcacagtgcaataacgcctaccagaattccaacttgagcgtggtggtgggaagt
gaagggcccttgaagggcgtccagatttggaaagtgccagctactgacacctacagtatc
tcgggctacggagcagctggcgggaaaggtgggaaaaacaccatgatgcggtcccatggc
gtgtctgtcctgggcatcttcaatctggagaaaggtgacacactctacatccttgtcggt
cagcaaggggaggatgcctgtcccagggcaaaccaactaatccagaaagtctgtgtcggc
gagaacaatgtcatagaagaagagatccgagtgaacagaagcgtgcacgagtgggcagga
ggaggaggaggtgggggtggagccacctacgtgtttaagatgaaagatggtgtgcctgta
cccctgatcattgcagctggtggtggtggcagggcctatggggccaagacagaaacgttc
cacccagagagactggagagtaactcctcggttctagggctgaacggcaattccggagcc
gcaggtggtggaggcggctggaatgataacacttccttgctctgggccggaaagtctttg
ctggagggtgccgctggaggacattcctgcccccaggccatgaagaagtgggggtgggag
acaagagggggtttcggagggggtggaggggggtgctcctcaggtggaggaggcggagga
tatataggtggcaacgcagcatcaaacaatgaccccgaaatggatggggaagatggggtt
tccttcatcagtccattgggtatcctgtacaccccggccttaaaagtgatggagggccat
ggggaagtgaatatcaagcattatctaaactgcagtcactgcgaggtagacgaatgtcac
atggaccccgagagccacaaagtcatctgcttctgtgatcatgggaccgtgctggctgat
gatggtgtctcctgcattgtgtcgcccaccccggagccccacctgccgctctcattgatc
ctctccgtcgtgacctctgccctggtggctgcccttgttctggcattctccggcatcatg
attgtgtaccgtcggaagcaccaggagttgcaggctatgcagatggagctgcagagcccc
gagtataagctgagcaagctgcggacctcgaccatcatgaccgactacaaccccaactac
tgcttcgctggcaagacttcatccatcagtgacctaaaggaagtgccgcggaaaaacatc
actctcatccggggcctaggccatggcgcatttggggaggtgtatgaaggccaggtgtct
ggaatgcccaatgacccaagccctctacaagtggctgtaaagacgctgccggaagtgtgt
tcagaacaagatgagctggactttctcatggaagctctgatcatcagcaaattcaaccac
cagaatattgttcgctgcatcggggtgagtctacaagccctgccccgcttcatcctgctg
gagctcatggctggcggagacctcaagtccttcctcagggagacacgccctcgcccgaac
caacccacctccctggccatgttggatcttctgcatgtggctcgggacattgcctgtggc
tgtcagtacctagaggagaatcactttatccaccgggatattgctgctagaaactgtctg
ttgacctgcccaggagctggaagaatagcaaagattggagactttgggatggcccgagat
atctacagggccagctactaccgaaagggaggctgcgccatgctgccggtcaagtggatg
ccccctgaagccttcatggaagggatatttacctctaaaacagacacatggtcttttgga
gtgttgctatgggaaatattttctcttggatatatgccgtaccccagcaagagcaaccag
gaagttctggagtttgtcaccagtggaggacggatggacccgcctaagaactgccccggg
cctgtataccggataatgacgcagtgctggcagcatcagcccgaagacagacccaacttt
gccatcattttggagaggatcgaatactgcacccaggaccctgatgtgatcaacacagct
ctgcccatcgaatacggtccagtagtagaagaggaggagaaagtgcccatgcgccccaaa
gaccccgaagggatgccgcctttgctggtgtctccccagcctgcgaagcaggaggaggcg
tccgcagctccccagcccgcagccctgacggcaccaggcccattggtgaagaagcccccg
ggtgcgggagcgggtgctggtgctggtgccggtgccggcccggtgccccgaggtgcggcc
gatcggggccacgtgaacatggcgttctctcagcccaaccctctcccggagctgcacaaa
ggcccgggatccagaaacaagccgaccagcctgtggaaccccacctacggctcttggttc
accgagaagcctgccaaaaagacccatcctccgccgggcgccgagccgcaggcgcgggca
ggagcggccgagggtggctggaccgggccgggcgcggggccccgcagagccgaggctgcg
ctgctgctcgagccatcggcgctgagcgccaccatgaaggaggtgccgctgttcaggctg
cgccacttcccctgcggcaacgtcaactatggttaccagcaacagggtctccccttggaa
gccacagctgcgccgggggacaccatgctgaaaagcaagaataaggtcacccagccgggg
ccctga

DBGET integrated database retrieval system