KEGG   Mus caroli (Ryukyu mouse): 110284402
Entry
110284402         CDS       T05910                                 

Gene name
Vegfa
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05219  Bladder cancer
mcal05323  Rheumatoid arthritis
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284402 (Vegfa)
   04014 Ras signaling pathway
    110284402 (Vegfa)
   04015 Rap1 signaling pathway
    110284402 (Vegfa)
   04370 VEGF signaling pathway
    110284402 (Vegfa)
   04066 HIF-1 signaling pathway
    110284402 (Vegfa)
   04020 Calcium signaling pathway
    110284402 (Vegfa)
   04151 PI3K-Akt signaling pathway
    110284402 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110284402 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110284402 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284402 (Vegfa)
   05206 MicroRNAs in cancer
    110284402 (Vegfa)
   05205 Proteoglycans in cancer
    110284402 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110284402 (Vegfa)
   05211 Renal cell carcinoma
    110284402 (Vegfa)
   05219 Bladder cancer
    110284402 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110284402 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110284402 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110284402 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110284402 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110284402 (Vegfa)
   05165 Human papillomavirus infection
    110284402 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110284402 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110284402 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110284402 (Vegfa)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110284402 (Vegfa)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110284402 (Vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF Cnd1_N
Other DBs
NCBI-GeneID: 110284402
NCBI-ProteinID: XP_021005804
Ensembl: MGP_CAROLIEiJ_G0021655
UniProt: A0A6P5NV59
LinkDB
Position
17
AA seq 214 aa
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKTHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggcgagcagaagacccatgaagtgatc
aagttcatggacgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgtgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagatagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system