KEGG   Mus caroli (Ryukyu mouse): 110284455
Entry
110284455         CDS       T05910                                 

Gene name
Apc
Definition
(RefSeq) adenomatous polyposis coli protein
  KO
K02085  adenomatosis polyposis coli protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04810  Regulation of actin cytoskeleton
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110284455 (Apc)
   04390 Hippo signaling pathway
    110284455 (Apc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110284455 (Apc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110284455 (Apc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284455 (Apc)
   05206 MicroRNAs in cancer
    110284455 (Apc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284455 (Apc)
   05225 Hepatocellular carcinoma
    110284455 (Apc)
   05226 Gastric cancer
    110284455 (Apc)
   05217 Basal cell carcinoma
    110284455 (Apc)
   05213 Endometrial cancer
    110284455 (Apc)
   05224 Breast cancer
    110284455 (Apc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284455 (Apc)
   05022 Pathways of neurodegeneration - multiple diseases
    110284455 (Apc)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110284455 (Apc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284455 (Apc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110284455 (Apc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110284455 (Apc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110284455 (Apc)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110284455 (Apc)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110284455 (Apc)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     110284455 (Apc)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 110284455
NCBI-ProteinID: XP_021005830
Ensembl: MGP_CAROLIEiJ_G0022085
UniProt: A0A6P5NSI2
LinkDB
Position
18
AA seq 2841 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDETM
TSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRA
FVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQT
DMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAEA
ERSSQSRHDAASHEADRQHEGHGVAESNTAASSSGQSPAARVDQEPASVLSSSGAHSAPR
RLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHG
NDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWE
WQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVD
CEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQ
VIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTEN
KADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCL
QTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGS
AAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPK
ASHRSKQRHKQNLYGDYAFDANRHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLD
SSRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQD
DRSSASTTEFHCVADDRSAARRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSND
SLNSVTSSDGYGKRGQMKPSVESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELD
TPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSENT
DDKHLKFQPHFGQQECVSPYRSRGTSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKPTN
YSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNS
SAQSTKPEHISPSSESTAAPSSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTY
CVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKENDVTRSTEDPATE
VPAVSQNARTKPSRLQASGLSSESTRHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPL
VFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPP
PQTVQAKREVPKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDADTLLHFATESTPDGFSC
SSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQDKEEEKPDSEKDL
LDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPSQNR
LQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGMQSGE
FEKRDTIPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFRV
KKIMDQVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEE
TFSDNKDSKKQSLKANAKAFNDKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSLS
SLDFDDDDVDLSREKAELRKGKESKNSEANVTCHPEPSSSQQAASKSQASIKQPANRGQS
KPVLQKQPTFPQASKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNK
ESEPIKEAEPTDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQEC
ISSAMPKKKRPSRLKGESEKQSPRKVGGLLAEDLTLDLKDIQRPDSEHGLSPDSENFDWK
AIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTS
NKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLLTNM
PSISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSE
LSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPPNK
LSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLNKQAGLSKNASSIPRSESASKGL
NQMNNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESAS
FESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYDDGR
PAKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESS
EKAKSEDERHVSSVPAPRQMKENQVPTKGTWRKIKESDISPTSMASQSASSGAASGAESK
PLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTH
GKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAETAETCIAERTPF
SSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSNNTKKRDSKTDS
TESSGAQSPKRHSGSYLVTSV
NT seq 8526 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaagcagctacagggaagtattgaagatgagactatg
acttctggacagattgacttactagagcgtcttaaagaatttaacttagatagtaatttc
cccggagtgaaactacgctcaaaaatgtcccttcgctcctatggaagtcgggaaggatct
gtatcaagccgttcaggagaatgcagtcctgtccccatggggtcattcccaagaagagca
tttgtaaatggaagccgagagagtactgggtatctagaagagcttgaaaaagaaagatca
ttactccttgctgatcttgacaaagaagagaaggaaaaggactggtattatgctcaactt
cagaacctcacaaaaagaatagatagcctgcctttaactgaaaatttttccttacagaca
gacatgacaagacggcagctggagtatgaagcaaggcagatcagggctgcaatggaggag
cagcttggcacctgccaggacatggagaagcgtgcacagcgaagaatagccaggatccag
caaatagaaaaggacatactgcgcgtgcgccagcttttacagtcccaggcggcggaagca
gagaggtcatctcagagcaggcatgatgctgcctcccatgaagctgaccggcagcacgaa
ggccacggagtggcagaaagcaacaccgcagcctccagtagtggtcagagtccggctgca
cgtgtggatcaggaaccagccagtgttttgagttctagcggcgcgcactctgctcctcga
aggttgacaagtcatctggggactaaggtggaaatggtgtattccttgttgtcaatgctt
ggtactcatgataaggacgatatgtcacgaactttgctagctatgtccagctcccaagac
agctgtatatccatgcggcagtctggatgtcttcctctcctcatccagcttttacatggc
aatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgggccagg
gccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggcaggcgt
gaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgttgggag
tggcaggaagcccacgaacaaggcatggaccaggacaaaaacccaatgcccgctcctgtt
gaacatcagatctgccctgccgtgtgcgtgctaatgaagctttcgtttgatgaagagcat
aggcatgcaatgaatgagcttgggggactgcaggccattgcagagttattgcaggtggac
tgtgagatgtatgggcttactaatgaccactacagtgttactttaagacggtatgctgga
atggctttgacaaacttgacctttggagatgttgccaacaaggctacgctgtgttccatg
aaaggctgcatgagagcccttgtggcccagttaaaatctgaaagtgaagacttacagcag
gttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagcaaaaagacg
ttgagagaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaaaaggaa
tcaaccctcaaaagcgtcttgagtgccttatggaacctgtctgcacactgtactgagaat
aaggctgacatctgtgccgtggatggagcactggcatttctggttggcaccctcacttac
cggagccagacaaatactttagccattattgaaagtggaggtgggatattacggaatgtg
tccagcttgatagctacaaacgaagaccacaggcaaatcctaagagagaacaattgccta
caaactttattacagcacttgaaatctcacagcttgacaatagtcagtaatgcatgtgga
actttgtggaatctctcagcaagaaatcctaaagaccaggaagccttgtgggacatgggg
gcagtgagcatgctcaagaacctcattcattccaagcacaaaatgattgccatgggaagt
gcagcagctttaaggaatctcatggcaaacagacctgcaaagtataaggacgccaatatc
atgtctcccggttcaagtctgccatcccttcacgttaggaaacagaaagctctagaagct
gagctagatgctcagcatttatcagaaaccttcgacaacattgacaacctaagtcccaag
gcctctcaccgtagtaagcagagacacaagcagaatctttatggtgactatgcttttgac
gccaatcgacatgatgatagtaggtcagacaatttcaatactggaaacatgactgttctt
tcaccgtatttaaatactacagtattgcccagctcttcttcctcaaggggaagtttagac
agttctcgttctgagaaagacagaagtttggagagagaacgaggtattggcctcagtgct
taccatccaacaacagaaaatgcaggaacctcttcaaaacgaggtctgcagatcactacc
actgcagcccagatagccaaagttatggaagaagtatcagccattcatacctcccaggac
gacagaagttctgcttctaccaccgagttccattgtgtggcagacgacaggagtgcggca
cgaagaagctctgcctcccacacacactcaaacacatacaacttcactaagtcagaaaat
tcaaataggacatgctctatgccttatgccaaagtggaatataaacgatcttccaatgac
agtttaaatagtgtcactagtagtgatggatatggtaaaagaggccaaatgaaaccctca
gttgaatcctattctgaagatgatgaaagtaaattttgcagttatggtcagtatccagct
gacctagcccataagatacacagtgcaaatcatatggatgataatgatggagaactggat
acaccaataaattacagtcttaaatattcagatgagcagttgaactcaggaaggcagagt
ccctcacagaatgaaaggtgggcaagaccaaagcatgtgatagaagacgaaataaagcaa
aacgagcaaagacaagcaagaagccagaacaccagttatcctgtctattctgagaatact
gatgacaaacacctcaaattccaaccacattttggacaacaagaatgtgtttccccatat
aggtcaaggggaaccagtggttcagaaacaaatcgaatgggttctagtcatgcaattaat
caaaatgtaaaccagtctctgtgtcaggaagatgattatgaagatgataaacctaccaac
tacagtgaacgttattctgaggaagaacaacatgaagaagaagaagagagaccgaccaat
tatagcataaaatataatgaagagaaacatcatgtggatcagcctattgattatagttta
aaatatgccactgacatttcttcctcacaaaaaccatcattttcattctcaaagaattca
tcagcacaaagcactaaacctgaacatatctctccaagcagtgagagtacagctgcacct
tcatctaatgccaaaaggcagaatcagctgcgtccaagttcagcacaaagaaatggtcag
actcaaaaagggactacttgcaaagtcccctccatcaaccaagaaacaatacagacttac
tgcgtagaagacaccccaatatgtttttcaaggtgcagttcattatcttcactgtcatca
gctgaagatgaaataggatgtgatcagacaacacaggaagcagattctgctaatactctg
cagatagcagaaataaaagagaatgatgtaacccggtcaactgaagatcctgcaactgaa
gttccagcagtgtcccagaatgctagaaccaaacccagccgactccaggcttctggctta
tcttcagaatcaaccaggcataaagctgttgagttttcttcaggagccaagtctccctcc
aaaagtggtgctcagacacccaaaagtcccccagaacactatgtccaggagaccccactg
gtattcagcaggtgtacttctgtcagctcacttgacagttttgagagtcgctccattgcc
agctctgttcagagtgagccatgtagtggaatggtgagtggcatcataagccccagtgac
cttccagatagtcctgggcagaccatgccaccaagcagaagcaaaacccctccacctcct
ccacagacagtgcaggccaagagagaggtgccaaaaagtaaagtccctgctgctgagaag
agagagagtggacctaagcagactgctgtaaatgctgccgtgcagagggtgcaggtcctt
ccagacgcggacactttgttacacttcgccacagaaagtactccagatgggttttcctgt
tcctccagcctaagtgctctgagcctggatgagccatttatacagaaagatgtagaatta
agaataatgcctccagttcaggaaaacgacaatgggaatgaaactgaatcagaacagcct
gaggaatcaaatgaaaaccaggataaagaggaagaaaagcctgactctgaaaaagactta
ttagatgattctgatgacgatgatattgaaatattagaagagtgtattatttcagccatg
ccgacaaagtcatcacgcaaagccaaaaaactagcccagactgcttcaaaattacctcca
cctgtggcaaggaaaccaagtcagctgcctgtgtataaacttctgccatcacagaatagg
ctgcaggcacaaaaacatgttagctttacaccaggggatgatgtgccccgggtgtactgt
gtagaagggacacctataaacttttccacagcaacatctctaagtgatctgacaatagag
tcccctccaaatgagttggctactggagatggggtcagagcggggatgcagtcaggtgaa
tttgaaaaacgagataccattcctacagaaggcagaagtacagatgatgctcagcgagga
aaaatctcatctatagttacaccagacctggatgacaacaaagcagaggaaggagatatt
cttgcagaatgtatcaattctgctatgcccaaaggaaaaagccacaagcctttcagagtg
aaaaagataatggaccaagtccaacaagcatcctcgacttcatctggagctaacaaaaat
caagtagacactaagaaaaagaagcctacttcaccagtaaagcccatgccacaaaatact
gaatatagaacgcgtgtgagaaagaatacagactcaaaagttaatgtaaatactgaagaa
actttctcagacaacaaagactcaaagaaacagagcttaaaagccaatgccaaggccttc
aatgataagctacctaacaatgaagacagagtgcgggggagcttcgctttggactcaccg
catcactacacccctattgagggaacgccgtactgcttctcccgaaatgactccttgagt
tctctggattttgatgatgacgatgttgacctttccagggaaaaggctgagttaaggaag
ggcaaagaaagcaagaattccgaagccaatgttacctgccacccagaaccaagctcaagc
cagcaggcagctagtaagtcacaagccagtataaaacagccagcaaacagaggacagtcc
aaaccagtgctgcagaaacagcccacattcccccaggcctccaaagacggaccagacaga
ggggcagcaactgacgaaaaactgcagaattttgctattgaaaatactccagtttgcttt
tctcgaaattcctctctgagttcccttagtgacattgaccaggaaaacaacaataacaaa
gaaagtgaaccaatcaaagaagctgaacctaccgactcacaaggagaaccaagtaaacct
caggcatctgggtatgctccgaagtcatttcatgttgaagacacccctgtctgtttctca
agaaacagctctctcagttctcttagcattgactctgaggacgacctgttacaggagtgt
ataagttctgccatgccaaaaaagaaaaggccttcaagactcaagggtgagagcgaaaag
cagagtcctagaaaagtgggtggcctattagctgaagacctgacacttgatttgaaagat
atacagaggccagattcagaacacggtttatcccccgactcagaaaattttgactggaaa
gctattcaggaaggcgcaaactccatagtaagtagtttgcaccaagctgctgcagccgcc
gcatgtttatctagacaggcgtcatctgactcagattccattctgtcactaaagtctggc
atttctctcggatcgccttttcatcttacacctgatcaagaggaaaagccattcacaagc
aataaaggcccaaggattctcaaacctggagagaaaagcacactagaagcaaaaaaaata
gaatctgaaaacaaaggaatcaaaggcggaaaaaaggtttataaaagcctgattacggga
aagattcgatccaattcagaaatttccagccaaatgaaacaacccctcctgacaaacatg
ccttcaatctcaagaggcaggacaatgattcacatcccagggcttcggaatagctcctct
agtacaagccctgtctctaagaaaggcccgcccctcaagactccagcctctaaaagcccc
agtgaagggccgggagctaccacttctcctcgaggaactaagccagcaggaaagtcagag
cttagccctatcaccaggcaaacttcccaaatcagtgggtcaaataaggggtcttctaga
tcaggatctagagactccactccctcaagacctacacagcaaccattaagtaggccaatg
cagtctccagggcgaaactcaatttcccctggtagaaatggaataagccctcctaacaaa
ctgtctcagctgcccagaacatcatctcccagcactgcttcaactaagtcctccggttct
gggaaaatgtcatatacatccccaggtagacagctgagccaacaaaatcttaacaaacag
gcaggtttatccaagaatgccagcagtatccccagaagtgagtcagcatctaaaggactg
aatcagatgaataacggcaatgggtcaaacaaaaaggtagaactttctagaatgtcttca
actaaatcaagtggaagtgaatcagacagatcagaaaggcctgcattagtacgccagtct
actttcatcaaagaagccccaagcccaaccctaaggaggaaactggaggaatcggcctca
tttgaatccctttctccatcttctagaccagattctcccaccaggtcccaggcacagacc
ccagttttaagcccttccctccctgatatgtctctgtccacacatccatctgttcaggca
gggggatggcgaaagctcccacctaatctcagccccactattgagtatgatgatggaagg
cccgcaaaacggcatgatattgcacgctcccattctgaaagtccttccagactaccaatc
aaccgggcaggaacctggaagcgtgaacacagcaaacattcctcgtcccttcctcgagtg
agcacttggagaagaactggaagctcatcttctattctttctgcttcatcagagtccagt
gaaaaagcaaaaagtgaggatgaaaggcatgtgagctccgtgccagcacccagacagatg
aaggaaaaccaggtgcccaccaaaggaacatggaggaaaataaaggagagtgacatttct
cccacaagcatggcttctcagagcgcttcctcaggtgctgccagtggtgctgaatccaag
cctctgatctatcagatggcacctgctgtctctaaaacagaggatgtgtgggtgagaatt
gaggactgccccattaacaaccctagatctggacggtcccccacaggcaacaccccccca
gtgattgacagtgtttcagagaagggaagttcaagcattaaagattcaaaagacacccac
gggaaacagagtgtgggcagtggcagtcctgtgcaaaccgtgggtctggaaacccgcctc
aactcctttgttcaggtagaggccccagaacagaaaggaactgaggcaaaaccaggacag
agtaacccagtctctatagcagagactgctgagacttgtatagcagagcgtacccctttc
agttccagtagctccagcaagcacagctcacctagtgggactgttgctgccagagtgaca
ccttttaattacaaccctagccctaggaaaagcagcgcagacagcacttcagcccggcca
tctcagatccctacgccagtgagcaacaacacaaagaagagagattcaaagactgacagc
acagaatccagtggagcccaaagtcctaaacgccattctgggtcttacctcgtgacgtct
gtttaa

KEGG   Mus caroli (Ryukyu mouse): 110303367
Entry
110303367         CDS       T05910                                 

Gene name
Apc2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04810  Regulation of actin cytoskeleton
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110303367 (Apc2)
   04390 Hippo signaling pathway
    110303367 (Apc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110303367 (Apc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110303367 (Apc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303367 (Apc2)
   05206 MicroRNAs in cancer
    110303367 (Apc2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110303367 (Apc2)
   05225 Hepatocellular carcinoma
    110303367 (Apc2)
   05226 Gastric cancer
    110303367 (Apc2)
   05217 Basal cell carcinoma
    110303367 (Apc2)
   05213 Endometrial cancer
    110303367 (Apc2)
   05224 Breast cancer
    110303367 (Apc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110303367 (Apc2)
   05022 Pathways of neurodegeneration - multiple diseases
    110303367 (Apc2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110303367 (Apc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110303367 (Apc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110303367 (Apc2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110303367 (Apc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110303367 (Apc2)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110303367 (Apc2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110303367 (Apc2)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     110303367 (Apc2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Suppressor_APC Arm SAMP bZIP_1 HALZ
Other DBs
NCBI-GeneID: 110303367
NCBI-ProteinID: XP_021030134
Ensembl: MGP_CAROLIEiJ_G0015576
LinkDB
Position
10
AA seq 2272 aa
MTSSMASYEQLVRQVEALKAENTHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQTDISSLYNLKFHAPALGPEPAARTPEGSPVHGSGPSKDSF
GELSRATIRLLEELDQERCFLLSEIEKEEKEKLWYYSQLQGLSKRLDELPHVDTFSMQMD
LIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQAL
LAVKPVAVEEEQEAEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSS
PESCVAMRRSGCLPLLLQILHGTEAGSVGRAGIPGAPGAKDARMRANAALHNIVFSQPDQ
GLARKEMRVLHVLEQIRAYCETCWDWLQARDSGTETPVPIEPQICQATCAVMKLSFDEEY
RRAMNELGGLQAVAELLQVDYEMHKMTQDPLNLALRRYAGMTLTNLTFGDVANKATLCAR
RGCMEAIVAQLGSESEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMECVLRASKE
STLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYRCQGNSLAVIESGGGILRNV
SSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRDQELLWDLG
AVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAAMAVSPGTCVPSLYVRKQRALE
AELDTRHLVHALSHLEKQGLPEAETTSKKPLPPLRHLDGLVQDYASDSGCFDDDDAPSLA
AAATTAEPASPAVMSMFLGGPFLQGQALARTPPARQGGLEAEKEAGGEAAVAAKAKAKLA
LAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGTEGGRREAGSR
AHPLLRLKAAHTSLSNDSLNSGSTSDGYCTREHMTPCPLAALAEHRDDPVRGQTRPSRLD
LDLPSRAELPARDTAATDARVRTIKLSPTYQHVPLLDGAAGAGVRPLVGPGTSPGARKQA
WIPADSLSKVPEKLVASPLPMASKVLQKLVAQDGPMSLSRCSSLSSLSSTGHAVPSQAEN
LDSDSSLEGLEEAGEAELGRAWRASGSTSLPVSIPAPQRGRSRGLGVEDATPSSSSENCV
QETPLVLSRCSSVSSLGSFESRSIASSIPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSK
TPPAPPGQPETSQFSLQWESYVKRFLDIADCRERCQPPSELDAGSVRFTVEKPDENFSCA
SSLSALALHELYVQQDVELRLRPPACPERGVGGGGHRRRDEAASRLDGPAPAGSRARSAT
DKELEALRECLGAAMPARLRKVASALVPGRRALPVPVYMLVPAPARGDDSGTDSAEGTPV
NFSSAASLSDETLQGPSRDKPAGPGDRQKPTGRAAPARQTRSHRPKAAGAGKSTEHTRGP
SRNRAGLELPLSRPQSARSNRDSSCQTRTRGDGALQSLCLTTPTEEAVYCFYDSDEEPPA
TAPPPRRASAIPRALKREKPAGRKETPSRAAQPVTLPVRAQPRLIVDETPPCYSLTSSAS
SLSEPEASEQPASHALGQKQGSKQDSSPSPRAEEELLQRCISLAMPRRRTQMPGSRRRKP
RAVRSDIRPTEITQKCQEEVAGSDPASDLDSVEWQAIQEGANSIVTWLHQAAAKASLEAS
SESDSLLSLVSGVSAGSTLQPSKLRKGRKPAAEAGGAWRPEKRGTTSTKINGSPRLPNGP
EKAKGTQKMTAGESTMLRGRTVIYSAGPASRTQSKGISGPCTTPKKTGTSGTTQPETVTK
APSPEQQRSRSLHRPGKISELAALRHPPRSATPPARLVKTPSSSSSQTSPASQPLPRRSP
LATPTGGPLPGPGGSPVPKSPARALLAKQHKTQKSPVRIPFMQRPARRVPPPLARPSPEP
GSRGRAGAEGTPGARGSRLGLVRMASARSSGSESSDRSGFRRQLTFIKESPGLLRRRRSE
LSSADSTASTSQAASPRRGRPALPAVFLCSSRCDELRVSPRQPLAAQRSLQAKPGLAPRA
PRRTSSESPSRLPVRASPGRPETVKRYASLPHISVSRRPDSAVSVPTTQANATRRGSDGE
ARPLPRVAPPGTTWRRIKDEDVPHILRSTLPATALPLRVSSPEDSPAGTPQRKTSDAVVQ
TEDVATSKTNSSTSPSLESRDLPQASASGPVAPQGSDVDGPVLTKPPASAPFPHEGLSAV
IAGFPTSRHGSPSRAARVPPFNYVPSPMAAATMASDSAVEKAPVSSPASLLE
NT seq 6819 nt   +upstreamnt  +downstreamnt
atgaccagctccatggcctcatatgagcagctggtgcgccaggtggaggccctgaaggcc
gagaacactcacttaaggcaggagctgagggataactctagccatctctccaagctcgag
acagagacttctggaatgaaggaggtcctgaaacaccttcagggcaagctggagcaggag
gcgagagtgctcgtgtcttccgggcagacagaagtgttagagcaactgaaagctcttcaa
actgacatcagtagcctgtacaacctcaagttccatgctccagccctgggcccggagcct
gccgcccggactccagagggaagcccagtgcacggctctggaccatccaaggacagcttt
ggagagctgagccgggccaccatccgcctgctggaagaactggatcaggagagatgcttc
ctgctgagcgagatagagaaagaggagaaggagaagctatggtattactctcagctccag
ggcctgtccaagcgcttggatgagctgccccacgtggacacgttttcgatgcagatggat
ctgattcggcagcagctggagttcgaggcccagcacatccgctcgctgatggaggagcgc
ttcggtacctccgacgagatggtgcagcgggcgcagatccgggcttcgcgcttggagcag
attgacaaggagctgttggaagcccaggaccgggtgcagcagacagagcctcaggctctg
ctggcggtgaagcctgtggcagtggaggaggagcaggaggcagaagtccccacacaccct
gaggatggcacccctcagcctggcaacagcaaggtggaggtggtgttctggctactatct
atgttggcaacgcgcgaccaggaagatactgcgcgcacactgctggccatgtccagctcg
ccagagagctgtgtagccatgcgccgctcgggctgtctgccactgctgctccagatcctt
catggcactgaggctgggtctgtggggcgcgcagggatccccggagcgcctggtgccaaa
gatgcacgcatgcgcgccaacgcggccctgcacaacatcgttttctcccagccagatcag
ggcctggcacgcaaggagatgcgtgtgctgcatgtgctggagcagatccgagcctactgc
gagacctgctgggactggcttcaggcgcgggacagcgggacagaaactcctgtcccaata
gagccacagatctgccaggctacctgtgcagtgatgaagctgtcatttgacgaagaatac
cgtcgggctatgaatgagctagggggcctgcaggctgtggcagaactactgcaggtggat
tatgaaatgcacaagatgacccaggacccactcaaccttgccctgcgccgctacgctggc
atgaccctcaccaacctcacctttggagacgttgccaacaaggccacactgtgtgcccgc
cgaggctgcatggaagctattgtggcccagcttggctctgagagcgaggagctgcatcag
gttgtttccagtattctgcgtaatctgtcatggagggcagacatcaacagcaagaaggtg
ctgagggaggttggcagcatgaccgccttgatggaatgtgtgctgcgggcctccaaggag
tcgaccctaaagagtgtgctcagcgctctgtggaacctgtcggcacacagcacagagaac
aaggcggccatctgccaggtagatggtgcactgggtttcctggtgagcaccctcacatac
cgttgccaagggaactccctggcagtcattgagagtggcggtgggatcctgcgcaacgtg
tcaagcctcattgccacacgggaggactacaggcaggtgctccgtgaccacaactgcctg
cagacactactgcagcacctcacatcacacagtttgaccatcgtgagcaatgcctgcggc
accctctggaacctgtctgcccgcagcccccgcgatcaggaactattgtgggacctgggg
gccgtgggcatgctacgcaaccttgtccactccaaacacaagatgatcgccatgggtagt
gctgctgctctgcggaacctgctagcccaccgacccgccaagtatcaggccgcagccatg
gctgtctccccaggcacctgcgtgcccagtctgtacgtccgcaagcagagggctctggaa
gctgagttggacactcggcacctggtgcatgcactcagtcacttagagaagcagggtctg
cctgaggcagagaccacttcaaagaaacccctgccacctctccgccacctggacgggctg
gtgcaggactatgcctctgattctggctgctttgatgatgatgatgcaccatccctggct
gctgcggccaccacagctgagcctgccagcccagcagtgatgtctatgttccttggcggt
cccttccttcagggccaggcactggcccgcaccccacctgcccgccagggtggcctagaa
gccgagaaggaggctggtggggaggcagctgtggctgccaaggccaaggccaagctggcc
ttggctgtggctcggattgaccgattggtggaggacatctctgccctgcacacctcatca
gacgacagcttcagtctcagctcgggggaccctgggcaggaggcaccaagggagggccgt
gctcagtcctgctctccatgccggggcaccgagggtgggaggcgtgaggctggcagccgg
gcgcaccctctgctgaggctcaaggcagcccacaccagcctctcgaatgatagcttgaac
agcggtagcaccagcgatggctactgtacccgagaacacatgacgccttgcccgctggct
gcattggccgagcaccgtgatgaccctgtgcgcggacagactcggcccagtcgactggac
ctggaccttcccagccgggctgagcttcctgcccgggacacagcagccaccgatgcccga
gtgcgcacaatcaagttatccccaacctatcagcatgttccactgttggatggggctgct
ggggcaggtgttcgacccctggttgggccgggaacgtccccaggggctcggaaacaggca
tggatacctgcagacagcctgagcaaagtccctgagaaactggtggcctctccactgccc
atggctagcaaggtgctgcagaagctggtggcacaggatgggccgatgtccctctccagg
tgcagctctctgtcctctctgtcttccacgggccatgccgtccctagccaggcggagaac
cttgacagcgattcatccctggaggggcttgaggaggctggtgaggctgagctgggtagg
gcgtggcgagcatctgggtccacctctcttccggtgtccatcccagccccgcagcggggg
cgcagtagaggtcttggggtggaggatgcaacaccatccagctcatctgagaactgcgtc
caggagacgcccttggtcctgagccgttgtagttccgtgagctccctggggagcttcgag
agccgctccattgccagctccatccccagtgacccgtgcagtgggctgggcagtggcact
gtgagtcccagcgagctgccagacagccccgggcagacgatgccaccaagccgcagcaag
acgccaccggcacctcctgggcagcctgagaccagccagttcagcctgcagtgggaaagc
tatgtgaaacgcttcctagacatcgcagactgtcgagaaagatgccagccgccctcggag
ctggacgcgggcagcgttcgcttcacagtggagaagccagacgagaatttctcctgcgcc
tccagcctcagtgcactggccctgcatgagctgtatgttcagcaggatgtggagctgcgt
ctgaggccacctgcctgcccagagcgtggggtgggtggtgggggccaccgtcggagggac
gaggctgccagccgcttggatggtccagcaccagctggttctagggctcggtcagcaact
gataaagaactggaggctttgcgtgaatgcctaggggcagccatgcccgcccggctccgc
aaggtggcctcggccttggtgccgggccgccgcgcattgcccgtccctgtgtacatgtta
gtgcccgccccggctcggggtgatgactcaggcacggactctgcagagggcacacccgtt
aacttttccagtgcagcctcgctcagtgacgagaccttacagggaccctccagggacaag
ccggccggacctggggacaggcagaaacctacaggccgagctgcccctgccaggcagacc
cgatctcaccggcccaaggcagcaggcgctggtaagagcacagaacacacccgggggccc
agtaggaaccgggcaggattggagctacccctcagcaggccccagagtgctcggtccaac
agggatagctcatgccagacccggacccgcggagatggtgccctgcagtcgctatgcctc
acaacacccacagaggaagctgtgtactgcttctatgactctgatgaggaaccaccagcc
actgcaccaccacctcggcgggcatccgccatcccacgggctctaaagcgcgagaaaccc
gcaggcagaaaggagactccatccagggcggcccagcctgtcacacttcctgtgagagcc
cagcccagactgatcgtggatgagaccccgccctgctattccctgacttcctcagctagt
tccctcagtgagcctgaggcctctgaacagccggccagtcatgctctcggccagaagcag
ggtagtaaacaggacagctctcctagcccaagggcagaagaggaacttctgcagagatgt
atcagcttggccatgcccaggcgccggacccagatgcctggctcgcggcgtcgcaagccc
agagccgtgaggtcagacataaggcccactgagataacccagaaatgccaggaggaggtg
gctggctccgatccagcctctgacctggacagtgtggagtggcaggctatccaagagggc
gcaaactccattgtcacgtggctgcatcaggcagcggccaaagccagcctggaagcatct
tctgagtctgactccctcttgtctttggtgtccggggtgtcagcaggctccaccctccag
ccctccaagctcaggaaagggcgaaagcctgcagcagaggctggaggtgcctggcgtcct
gagaaacggggcacaacttccactaagatcaatgggagtccccggctacctaatggccct
gagaaggcaaagggtacccagaaaatgacggcaggggagtcgaccatgctccgagggcgg
acagtgatctactcagccggcccagcctcccgcactcagtccaaaggtatttctggacct
tgtaccacacctaagaagacagggacatctggtaccactcagccagaaactgtcaccaaa
gcccccagccctgagcaacaacgttcacggagcctccaccgaccgggcaagatctctgag
ctggcagctttgcgccacccgcccaggagtgccactcctccagcccgcctcgtcaagacc
ccgtcctcaagctcttcacagacctccccagcatcccagcccctgcctaggcggtcccct
ctggccactccaacaggaggacctctgcctggccctggggggtccccggtgcccaagtca
ccagcgcgggcccttctggctaagcaacacaagacccagaagtcacctgtgcggatccca
ttcatgcaaaggccagccaggcgagtgccacctccactggccaggccatccccagaacct
ggctctaggggccgagctggagctgagggtactcctggggcacgtggcagccgcctgggc
ctggtgcgaatggcgtcagctcgctccagtggcagcgagtcctcggatcgctcaggcttc
cgaaggcagctgactttcatcaaggaatccccaggtctccttcggcggcgcagatcagag
ctgtcctctgcggactccacagcctccacctcccaggccgcttcgccccgccgtggacgg
cctgcactccctgctgtctttctctgctcctctcgttgcgatgagctgcgggtatcccca
cggcagcccctggcagcacagaggtccctacaggccaagccaggtctcgcgccacgtgcg
cccagacgcaccagctctgagagcccctcacgcctgcctgtgcgggcgagccctggacgg
cctgagacagtcaagcggtacgcatccctgccacatattagtgtgtcccgcaggcccgat
agcgctgtctctgtgcccaccacccaggccaatgccacacgccggggaagtgatggcgag
gccaggccgctgcccagggtagctcctccgggtacgacctggcgtcgaatcaaagatgaa
gatgtcccccacatcctgcgcagcacgctgcctgccactgccctgcctctcagggtctcg
tcacccgaagacagccccgctggaactccacagcgcaagaccagtgacgcagtggtgcaa
acagaggacgtggccacttctaagaccaactctagcacgtcacctagcctggaaagcagg
gatctgccacaggcctcggctagcggccctgtggctccccagggcagcgatgtggatgga
ccagtactcaccaagcctcctgcctcagcgcccttcccccatgagggtctgagtgctgtc
atagcaggctttcccaccagcaggcatggctcccccagcagggctgcacgggttcccccc
ttcaactatgtgcccagccctatggcagcggccacaatggccagtgactccgcagtggag
aaagccccggtctcctctccagccagtctcctggagtag

DBGET integrated database retrieval system