KEGG   Mus caroli (Ryukyu mouse): 110284486
Entry
110284486         CDS       T05910                                 

Gene name
Kif5b
Definition
(RefSeq) kinesin-1 heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04728  Dopaminergic synapse
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110284486 (Kif5b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110284486 (Kif5b)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110284486 (Kif5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284486 (Kif5b)
   05012 Parkinson disease
    110284486 (Kif5b)
   05014 Amyotrophic lateral sclerosis
    110284486 (Kif5b)
   05016 Huntington disease
    110284486 (Kif5b)
   05020 Prion disease
    110284486 (Kif5b)
   05022 Pathways of neurodegeneration - multiple diseases
    110284486 (Kif5b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110284486 (Kif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110284486 (Kif5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110284486 (Kif5b)
   04147 Exosome [BR:mcal04147]
    110284486 (Kif5b)
Membrane trafficking [BR:mcal04131]
 Others
  Actin-binding proteins
   Others
    110284486 (Kif5b)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110284486 (Kif5b)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110284486 (Kif5b)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 110284486
NCBI-ProteinID: XP_021005881
Ensembl: MGP_CAROLIEiJ_G0021975
UniProt: A0A6P5NVB8
LinkDB
Position
18
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTADKDIAITSDKPAAAVGMAGSFTDAERRK
CEEELAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYEVLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGTVRGGGSFVQNNQPVGLRGGGG
KQS
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggcggagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgaa
tctgaagtgaaccgcggcgataagtacgtcgccaaattccagggagaagacacggtgatg
atcgcgtccaagccttatgcatttgatcgtgtgttccagtcaagcacatctcaagagcaa
gtatacaacgactgtgcaaaaaagattgttaaagatgttcttgagggctataatggaaca
atatttgcatatggacaaacatcatctgggaagacccacacgatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacttgttagatgtttcaaagactaacctttcagtccatgaagacaaaaat
cgtgttccctatgtaaaggggtgcacagaacgtttcgtgtgtagtccagatgaagtcatg
gatactatagatgaagggaaatccaacagacatgtagcagttacaaatatgaatgaacac
agctctaggagtcacagtatatttcttattaatgtaaaacaagagaatacacaaacggaa
cagaaactcagtggaaagctttatctggttgatttagctggcagtgaaaaggttagtaaa
actggggctgaaggtgctgtgctggatgaagctaagaacatcaacaagtcactttctgca
cttggaaatgtcatttctgctttggcagagggcagtacctatgttccttatcgagatagt
aaaatgaccagaattcttcaagattcattaggtggcaactgtaggaccactattgtcatt
tgctgctctccatcatcatacaatgagtctgagacaaagtcaacactcctctttggtcaa
agggccaaaacaattaagaacacagtctgtgtcaatgtagagttaactgcagagcagtgg
aaaaagaagtatgaaagagaaaaggaaaaaaataagactctacggaacaccattcagtgg
ctggaaaacgagctaaaccgatggcgtaatggggagacagtgcctattgatgagcagttt
gacaaagagaaagctaatttggaagccttcacagcagataaagatattgctattaccagt
gataaaccagctgctgcagtcggaatggctggtagttttaccgatgctgaaagaagaaag
tgtgaagaagaacttgctaaattgtataaacaacttgatgacaaggatgaagagattaac
caacaaagccaattggtggagaaattgaagacacagatgctggatcaggaagagcttctg
gcatcaaccagaagggatcaagataatatgcaagctgaactgaatcgcctccaagcagaa
aatgatgcttctaaagaagaagtcaaagaagttctacaggccttagaggaactggctgtt
aattatgatcagaagtctcaggaagttgaagacaaaacaaaggaatatgaagtgcttagt
gatgaattgaatcaaaaatctgcaactttagcaagtattgatgctgagcttcagaagctg
aaggaaatgaccaaccaccagaagaaacgagcagctgaaatgatggcatcattattaaaa
gaccttgcagaaataggaattgctgtggggaataacgacgtgaagcaaccagaaggaact
ggtatgatagatgaagagtttactgttgcaagactctacattagcaaaatgaaatcagaa
gtaaagaccatggtgaaacgttgcaaacagctagaaagcacacagactgagagcaacaaa
aaaatggaagaaaatgagaaagagttagcagcatgccagcttcggatctcccaacatgaa
gccaaaatcaagtcactgactgaataccttcaaaatgtagaacaaaagaagagacagctg
gaggaatctgttgattcccttggtgaggaactagtccaactccgagcacaagagaaagtc
catgaaatggaaaaagagcacttgaacaaggttcagactgcaaatgaagtcaagcaagct
gttgaacagcagatccagagtcacagagaaacccaccaaaaacaaatcagtagtttgcga
gacgaagttgaggcaaaggaaaagctaatcactgatctccaagaccaaaaccagaagatg
gtgctggagcaggaacggctaagggtggagcatgagaggctgaaggctacggaccaagag
aagagcaggaagctgcatgagctcacggttatgcaagacagacgagaacaagcaagacaa
gacttgaagggtttggaggagaccgtggcaaaagaacttcagactttacacaacctgcgt
aagctctttgttcaggacttggctaccagggtgaaaaagagcgccgaggtggactctgac
gacactggcggcagtgctgcacagaagcagaaaatctccttccttgaaaacaatcttgaa
cagctcaccaaagtgcacaagcagttggtacgcgataatgcagatcttcgctgtgagctt
cctaagttagagaaacggcttagagctactgcagaaagagtgaaagctttggagtcagcc
ctgaaagaagccaaagaaaatgcatctcgagaccgcaaacgctatcagcaagaagtagac
cggataaaggaagcagtcaggtcaaagaatatggccagaaggggacattctgcacagatt
gcaaagcctatccgtcctggacagcatccagcagcctctccaactcacccaggcacagtt
cgtggaggaggctcatttgttcagaacaaccagccagtggggcttcgtggtggtggaggc
aagcagtcgtaa

KEGG   Mus caroli (Ryukyu mouse): 110295751
Entry
110295751         CDS       T05910                                 

Gene name
Ret
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal05200  Pathways in cancer
mcal05216  Thyroid cancer
mcal05223  Non-small cell lung cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110295751 (Ret)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295751 (Ret)
   05230 Central carbon metabolism in cancer
    110295751 (Ret)
  09162 Cancer: specific types
   05216 Thyroid cancer
    110295751 (Ret)
   05223 Non-small cell lung cancer
    110295751 (Ret)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295751 (Ret)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110295751 (Ret)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  RET family
   110295751 (Ret)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 Pkinase Cadherin RET_CLD3 RIO1
Other DBs
NCBI-GeneID: 110295751
NCBI-ProteinID: XP_021019803
Ensembl: MGP_CAROLIEiJ_G0028784
UniProt: A0A6P5PNT3
LinkDB
Position
6
AA seq 1054 aa
MAKATSGAAGLGLKLILLLPLLGEAPLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAP
GEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLNQSLDHSSWEQLSIRNGGFPLLT
IFLQVFLGSTAQREGECHWPGCTRVYFSFINDTFPNCSSFKAQDLCIPETAVSFRIRENR
PPGTFYHFHMLPVQFLCPNISVKYNLLEGDSLPFRCDADCLEVSTRWALDRELREKYVLE
AACTVAGLSANKXTVTVSFPVTVYDEDDSAPTFSGGVGTASAVVEFKRKEVELILNRSLS
ISESRVLQLAVLVNDSDFQGPGAGGILVLHFNVSVLPVTLNLPRTYSFPVNKRARRYAQX
GKVCVENCQEFSGVSIQYKLQPSSTNCTALGVVTSPEDTSGTLFVNDTEALRRPECTKLQ
YTVVATDRQTRKQTQASLVVMVEGTSIAEEVGCPKSCAVNKRRPECEECGGLGSPTGRCE
WRQGDGKGITRNFSTCSPSTRTCPDGHCDAVESRDANICPQDCLRADIVGGHERGERQGI
KAGYGICNCFPDEKKCFCEPEDSQGPLCDVMCRTIIIIALFLFFILLSILCICHHHKQGH
KPPIASAEMTFCRPAQGFPISYSSSGTRRPSLDSMENQVSVDSFKIPEDPKWEFPRKNLV
LGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVNHP
HVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLDHPDERV
LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSY
VKKSKESHWGLWVKLGEEMHVMGLENFSKSKHHVDIRFTDDDLFPCLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAA
STPSDSLLYDDGLSEEETPLVDCNNXPLPRSLPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTSTGFPRYANDSVYANWMVSPSAAKLMDTFDS
NT seq 3165 nt   +upstreamnt  +downstreamnt
atggcgaaagcgacgtccggcgccgcagggctggggctgaagctgattttgctcctgccg
ctgctaggagaagccccactgggcctctacttctcaagggatgcttactgggagaggctg
tatgtggaccagccagctggcacacctctgctctatgtccatgccctacgggatgcccct
ggagaagtgccgagcttccgcctgggccagcatctctatggcgtctaccgtacacggctg
catgagaatgactggatccgtatcaatgagactactggccttctctacctcaatcagagc
ctggaccacagttcctgggaacagctcagcatccgcaatggtggtttccccctgctcacc
atcttcctccaggtcttcctggggtccacagcccagagagagggagaatgccattggcca
ggctgtacccgtgtgtacttctccttcatcaacgacaccttcccaaattgtagctccttc
aaagcccaggatctctgcatcccagagacagctgtgtccttccgaatcagggagaacagg
cctcctggcaccttctaccacttccacatgttacccgttcagttcctttgtcccaacatc
agtgtgaagtacaatctcttagaaggggacagtctgcccttccgttgtgacgcagactgc
ctggaggtgagcactcgctgggccctggatagagagctccgggagaagtatgtgctggag
gctgcgtgcacagtggcaggccttagtgccaacaaaganacggtgactgtgtccttcccg
gtgacagtgtacgacgaggacgactcggcacccaccttctctggaggtgtgggcactgcc
agcgctgtagtggagtttaagcgaaaggaggttgagctgattctcaacaggagcctgtct
atctcagagagccgagtcctgcagcttgcggtcctggtcaatgactcagacttccagggg
cctggggcaggtggtatcctcgtcctccatttcaatgtgtctgtgctgcctgtcaccctg
aacctacccaggacctactccttcccggtgaataagagggcccgccgttatgcccagatn
gggaaagtttgtgtggaaaactgccaggagttcagcggtgtctccatccagtacaagctg
cagccttccagcaccaactgcactgccctaggtgtggtcacctcgcccgaggacacctcg
gggaccctatttgtaaatgacacagaggccctgcggcgacctgagtgcaccaagcttcag
tacacggtggtagccactgaccggcagacccgcaaacagacccaggcttcactagtggtc
atggtggaggggacatccattgctgaagaagtaggctgccccaagtcctgtgcagtaaac
aagaggcgccccgagtgtgaggaatgtggtggcctgggttctccaactggcaggtgcgag
tggcgccagggagatggtaaagggatcaccaggaacttctccacctgctcccccagtacc
aggacctgccccgacggccactgtgatgctgtggagagccgggatgccaacatttgcccc
caggactgtctccgtgccgacattgttggggggcacgagcgaggggagcgccagggcatt
aaagctggctacggcatctgcaactgtttccctgatgagaagaaatgcttctgtgagcca
gaggacagccagggcccactgtgtgatgtgatgtgccgcacgatcatcataattgccctc
ttccttttcttcatcctgctgtccatcttatgcatctgccaccaccacaagcaagggcac
aagccgcccattgcatcagcggaaatgaccttctgccggccggcccagggcttcccaatc
agctactcctcctcaggcacccgccggccctcactggattccatggagaaccaggtttct
gtggactctttcaagatcccggaggatccaaagtgggaatttcctcggaagaacttagtt
cttgggaaaaccctaggagaaggcgagtttggaaaagtcgtcaaggccacagccttccgt
ctgaaaggccgggcaggatacaccacagtggctgtgaaaatgctgaaagaaaacgcctcc
cagagtgagttacgagacctgctgtctgagttcaaccttctgaaacaagtcaaccatcca
catgtcatcaagttgtatggggcctgcagccaggatgggccacttcttctcattgtggag
tatgccaagtatggctccctgcggggattcctccgtgacagccgcaagattggacctgcc
tacgtgagcggtggaggcagccgcaactccagctcgctggaccacccagatgaaagggta
ctgaccatgggtgacctcatctccttcgcctggcagatctcgaggggtatgcagtacttg
gcagaaatgaagctcgtacatcgggacttagctgccaggaacatcttggtggctgaggga
cggaagatgaagatttctgactttgggctgtccagagatgtttatgaggaagattcctat
gtgaagaaaagcaaggagtctcactggggtctctgggtaaaactgggcgaggagatgcat
gtcatgggtcttgagaatttctccaagtccaagcatcatgtggacatccgattcactgac
gacgatttgttcccatgcctgggaggcaacccttaccctggaattcctcctgaacgactc
ttcaaccttctgaagacaggccacaggatggagaggccagacaactgcagcgaggaaatg
taccgcctgatgctgcagtgctggaagcaggagccagacaagaggccagtgtttgctgac
atcagcaaggatctggagaagatgatggtcaagagcagagactacttggacctggctgca
tccaccccttcggactccctgctgtatgacgatgggctctcagaagaggagacacccctg
gtggactgtaacaatgntcccctcccgcgctccctcccttccacatggattgaaaacaaa
ctctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgagagcc
gatggcactagcactgggttcccaagatatgcaaatgatagtgtatatgctaactggatg
gtttcaccctcagcggcaaaattaatggacacatttgatagctaa

KEGG   Mus caroli (Ryukyu mouse): 110302771
Entry
110302771         CDS       T05910                                 

Gene name
Kif5a
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04728  Dopaminergic synapse
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110302771 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110302771 (Kif5a)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110302771 (Kif5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110302771 (Kif5a)
   05012 Parkinson disease
    110302771 (Kif5a)
   05014 Amyotrophic lateral sclerosis
    110302771 (Kif5a)
   05016 Huntington disease
    110302771 (Kif5a)
   05020 Prion disease
    110302771 (Kif5a)
   05022 Pathways of neurodegeneration - multiple diseases
    110302771 (Kif5a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110302771 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110302771 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110302771 (Kif5a)
   04147 Exosome [BR:mcal04147]
    110302771 (Kif5a)
Membrane trafficking [BR:mcal04131]
 Others
  Actin-binding proteins
   Others
    110302771 (Kif5a)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110302771 (Kif5a)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110302771 (Kif5a)
SSDB
Motif
Pfam: Kinesin Microtub_bd Spc7
Other DBs
NCBI-GeneID: 110302771
NCBI-ProteinID: XP_021029167
Ensembl: MGP_CAROLIEiJ_G0015887
UniProt: A0A6P5QLT2
LinkDB
Position
10
AA seq 1013 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTLHYSPQARELQTL
HNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQLVRDNADL
RCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSGKRGH
SAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQAAPSSTSDMYFASS
GATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS
NT seq 3042 nt   +upstreamnt  +downstreamnt
atggcggagactaacaacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtctttgaccgcgtcttccccccaaacaccactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggttacaatggc
acaatcttcgcttatggacagacatcctcagggaaaacgcataccatggaggggaagctg
cacgaccctcagctgatgggcatcattccccggatcgctcgagacatcttcaaccacatc
tactccatggatgagaaccttgaattccacattaaggtatcttacttcgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacaaacctgtccgtgcatgaggataaa
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgatcgatgaggggaagtccaaccgtcacgtagccgtcaccaacatgaatgag
cacagttctcggagccacagcatcttcctcatcaacatcaagcaggagaacgtagagacc
gagcagaagctcagcgggaagctgtacctcgtggatctggccggaagcgagaaggtcagc
aaaacaggggcagagggagccgttttggacgaggcaaagaatatcaacaagtcactgtcg
gccctggggaacgtgatctctgcactggcggagggcaccaaaagctacgtgccataccgt
gacagtaaaatgacgaggattctccaggactctctgggagggaactgcaggaccaccatg
ttcatctgctgctcgccgtccagctacaatgacgcagagaccaagtccacgctcatgttt
gggcagcgggcgaagaccatcaagaacactgcctcagtgaatctggagttgactgctgag
caatggaagaagaagtatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctggaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctgggagctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtgcgcatcgcacctgaggaaaggcagaaatatgaggaagag
atccgccgtctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccag
ctcattgagaagctgaagcaacagatgctggaccaggaagagctgctcgtgtccactcgg
ggagacaacgagaaggtccagcgggagcttagccacctgcagtccgagaatgatgctgca
aaggacgaggtgaaggaagtgctgcaggccctagaggagctggcagtcaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtcc
cagaaagtggccaccatgctgtccctggagtccgagctacagcggctccaggaggtcagt
ggacaccagcgaaagcggatcgctgaggtgctgaatgggctgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcctgtggagatcagtggggccatc
gaggaggagttcacggtggcccggctctacatcagcaagatcaagtcggaggtgaagtcc
gtggttaagcgatgtcggcagctggagaacctccaggtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcgtcttgccaactgctcatctcacagcacgaggccaagatc
cgttcactcacggagtacatgcagactgtggagttgaagaaacggcacctggaagagtcc
tacgactccctgagcgatgagcttgccaggctccaggcgcacgaaactgtgcacgaggta
gctctgaaagacaaggagccagacacacaggacgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcaccgtgaggcccatcaccggcagctggcccgcctccgggacgag
attaatgagaaacagaaaaccattgatgagctgaaagacctgaaccagaaactccagtta
gagctggagaagcttcaggctgactatgagaggctgaagaacgaagagaacgagaagagc
gccaagctccaggagctgactttgcattattccccccaggcccgtgaactccagaccctc
cacaaccttcgcaagctgttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaa
atggagcccgaggacagtggggggattcattcccaaaagcagaagatctcctttcttgag
aacaacctggaacagcttacaaaggttcacaaacagctggtacgtgacaatgcagatctg
cgttgtgagcttcctaaattggaaaaacgacttcgggctacggctgagagagttaaggcc
ctggagggtgcactgaaggaggccaaggagggcgctatgaaggacaagcgtagataccag
caggaggtggaccgcatcaaggaagccgtgcggtacaagagctccggcaagcggggccat
tctgcccagatcgctaagcctgtgaggcctggccactatcctgcctcctcacccaccaac
ccctacggcacccggagccccgagtgtatcagctacaccaacaacctcttccagaactac
cagaacctgcacctgcaggctgcgcctagctccacttcagatatgtactttgccagcagc
ggagccacatctgttgcccccttggcttcctaccagaaggccaacatggacaatggaaat
gccacagatatcaacgacaacaggagtgacctgccgtgtggctatgaggctgaggaccag
gccaagcttttccctctccaccaagagacagcagccagctaa

KEGG   Mus caroli (Ryukyu mouse): 110311369
Entry
110311369         CDS       T05910                                 

Gene name
Kif5c
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04728  Dopaminergic synapse
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110311369 (Kif5c)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110311369 (Kif5c)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110311369 (Kif5c)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110311369 (Kif5c)
   05012 Parkinson disease
    110311369 (Kif5c)
   05014 Amyotrophic lateral sclerosis
    110311369 (Kif5c)
   05016 Huntington disease
    110311369 (Kif5c)
   05020 Prion disease
    110311369 (Kif5c)
   05022 Pathways of neurodegeneration - multiple diseases
    110311369 (Kif5c)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110311369 (Kif5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110311369 (Kif5c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110311369 (Kif5c)
   04147 Exosome [BR:mcal04147]
    110311369 (Kif5c)
Membrane trafficking [BR:mcal04131]
 Others
  Actin-binding proteins
   Others
    110311369 (Kif5c)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110311369 (Kif5c)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110311369 (Kif5c)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110311369
NCBI-ProteinID: XP_021040283
Ensembl: MGP_CAROLIEiJ_G0023546
UniProt: A0A6P5R5W2
LinkDB
Position
2
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVL
QHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNITPVVDGISAEKEKYDEEI
TSLYRQLDDKDDEINQQSQLAEKLKRQMLDQDELLASTRRDYEKIQEELTRLQIENEAAK
DEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSN
HQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSL
VNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQ
DSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRL
RDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAR
EDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNL
EQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEV
DRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGGSSNSTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagattctccgcggggacaaattcatccccaaattcaaaggcgaggagacggtggtg
atcgggcaagggaagccgtatgtctttgaccgagtgctgccgcccaacacaacccaggag
caggtctacaatgcctgtgcaaagcagattgtcaaagatgtccttgagggttataatggg
acaatttttgcatacgggcagacttcatcaggaaaaactcataccatggaggggaagttg
catgatcctcagcttatgggcatcattccgaggattgcacatgatatttttgatcacatc
tattccatggacgagaacctggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaataagggacttgcttgatgtgtccaagaccaacttggcagttcatgaagacaaa
aacagagtcccctatgtaaaggggtgcaccgagaggtttgtgtcaagcccggaggaggtc
atggacgtgatcgatgagggcaaagcaaaccgacatgtggctgtgacaaacatgaacgaa
cacagctctaggagtcacagtatcttcctgattaatattaagcaagagaatgtggagact
gaaaaaaaactcagcgggaagctgtatttggttgatttggctgggagtgaaaaggtcagc
aaaaccggtgccgagggagctgttcttgatgaagctaaaaatatcaacaagtctttgtct
gctcttggaaatgtgatctctgccttggcagaagggacaaaaacacatgtaccataccgg
gacagcaagatgactcggattctccaggactctctgggtgggaactgtaggaccaccatt
gtcatttgctgttctccttcagtcttcaatgaagccgagaccaagtccacgctgatgttt
ggacagagagcaaagaccatcaagaatacagtctctgtgaacttggaactaacagcagaa
gagtggaaaaagaaatatgaaaaagagaaagagaagaacaaggccttgaagagtgtcctc
cagcatctggagatggagctgaacaggtggaggaacggggaagctgtacctgaggatgaa
cagatcagcgccaaggaccagaagagcctagagccctgcgacaacacacccatcatagac
aacatcacgcctgttgtggatggcatctctgccgagaaagagaagtatgacgaggagatc
accagtctgtaccgacagctagatgataaggatgatgaaattaaccagcagagccagctg
gctgaaaagctgaagcgacagatgctggatcaggatgagctcctggcttccacgagaagg
gactatgagaagatccaggaggagctgacacgcctccagatcgaaaatgaggcagctaaa
gacgaagtgaaagaagtcctccaggccctggaggagctggctgtcaattacgaccagaag
tcacaagaagtggaggacaagaccagggccaacgagcaactgactgatgagctggcccag
aaaacgacgacattgacaaccacgcagcgagagctgagtcagctgcaagagcttagtaac
caccagaaaaagagggccacagagatcctgaacctgctactcaaggacctgggggagatc
ggtggaatcattggcaccaacgacgtgaagactctggcagatgtgaacggggtcattgag
gaggagttcaccatggcacgcctgtacattagcaagatgaagtcggaggtcaagtctctc
gtgaaccgcagcaagcagctggagagtgcccagatggactctaacaggaagatgaatgcc
agtgagcgcgagctggcagcgtgccagttgcttatctcacagcatgaagccaagatcaag
tctctgacagactacatgcagaacatggaacagaagaggcggcagctggaagagtcccag
gactccctcagcgaggaactggccaagctccgggcccaggaaaaaatgcacgaagtcagt
ttccaagataaggaaaaggagcacctgacgaggctgcaggatgctgaggaggtgaagaaa
gctctggagcagcagatggagagtcaccgggaagcgcaccaaaagcagctgtccagactt
cgcgatgagattgaggagaagcagagaatcattgacgagattcgggatttgaatcagaaa
ctgcaactggaacaggagaggctcagctctgattataacaagctgaaaatagaggaccag
gagagagaagtgaaactggagaagctcctattgctcaatgacaaaagggagcaagccagg
gaggacctcaagggactggaggagactgtgtctagagaactccagacccttcataacctg
cgcaaactcttcgtccaagatttgaccacccgggtgaaaaagagtgtggagctggacagc
gatgatggagggggcagtgcggcccagaagcagaagatctccttcctggagaacaacctg
gaacagcttaccaaggtgcacaagcagctggttcgggacaatgcagatttgcgttgtgaa
ctccccaagctggagaagaggcttcgtgctaccgcagaacgtgtcaaggccttggagagt
gcactgaaagaggccaaggagaatgccatgagggaccgaaagcgctaccagcaggaagtg
gatcgcatcaaggaggctgtgcgagccaagaacatggccaggagggcacattcggctcag
atcgccaagcccatccgcccaggacattatccagcatcatctccaacagctgtccatgct
gtccgaggaggaggaggaggtggctcttcaaactctactcactaccagaaataa

DBGET integrated database retrieval system