KEGG   Mus caroli (Ryukyu mouse): 110284493
Entry
110284493         CDS       T05910                                 

Gene name
Ppp2r2b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110284493 (Ppp2r2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110284493 (Ppp2r2b)
   04071 Sphingolipid signaling pathway
    110284493 (Ppp2r2b)
   04151 PI3K-Akt signaling pathway
    110284493 (Ppp2r2b)
   04152 AMPK signaling pathway
    110284493 (Ppp2r2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110284493 (Ppp2r2b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110284493 (Ppp2r2b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110284493 (Ppp2r2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110284493 (Ppp2r2b)
   05165 Human papillomavirus infection
    110284493 (Ppp2r2b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110284493 (Ppp2r2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110284493 (Ppp2r2b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110284493 (Ppp2r2b)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110284493 (Ppp2r2b)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110284493 (Ppp2r2b)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110284493 (Ppp2r2b)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110284493 (Ppp2r2b)
SSDB
Other DBs
NCBI-GeneID: 110284493
NCBI-ProteinID: XP_021005894
Ensembl: MGP_CAROLIEiJ_G0022230
UniProt: A0A6P5NSL2
LinkDB
Position
18
AA seq 471 aa
MRKWNFGDGNSLCSVLKPSEWRNPADIISTVEFNHTGELLATGDKGGRVVIFQREQEVCT
EEQAPAVVLGSGLQVLKFNLPSFQSKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKI
NKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPV
LRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVD
IKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPS
NRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSL
YENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRK
VCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaggaaatggaattttggcgatggcaattcgttgtgctcagtcctaaagccaagcgag
tggcgaaatccagctgacattatctctacggtagaattcaaccacacgggagagttacta
gcgacgggggacaaggggggtcgggttgtaatatttcagcgagaacaggaggtgtgtaca
gaggagcaagctccagctgttgtcttgggatctggcctccaggtgttgaaattcaatctc
ccttcgtttcagagtaaaaaccaggttcatcgtaggggtgaatacaatgtttacagcaca
ttccagagccatgaacccgagttcgattacctgaaaagtttagaaatagaagaaaaaatc
aataagataagatggctccctcaacaaaacgcagcttactttcttctgtctaccaacgat
aaaactgtgaagctgtggaaagtcagtgagcgggataagaggccagaaggctacaacctg
aaagatgaggagggccggctccgggatcctgccaccatcacaaccctgcgggtacctgtc
ctgagacccatggacctgatggtggaggccaccccacgaagagtgtttgccaatgcgcac
acgtaccacatcaactctatatctgtcaacagcgactatgagacctacatgtctgctgat
gacctgaggattaacctgtggaactttgagataaccaatcagagttttaatatcgtggac
atcaagccagccaacatggaggagctcacggaggtgatcactgcagctgagttccacccc
caccactgcaacacctttgtatacagcagcagcaaggggacaatccggctgtgtgacatg
cgtgcatctgcgctgtgtgaccggcacaccaagttttttgaagagccggaagatccaagc
aacagatcgtttttctctgaaatcatctcttcaatttcggatgtgaaattcagccacagc
gggaggtatatcatgaccagagactatctgaccgtgaaagtctgggacctcaacatggaa
aatcgccccattgagacataccaggttcatgactacctccgcagcaagttgtgctccctc
tatgaaaatgactgcatttttgataaatttgagtgtgtgtggaatgggtcagacagcgtc
atcatgacgggctcctacaataacttcttcaggatgttcgaccgaaacaccaagcgtgat
gtgacccttgaggcctcaagggaaaacagcaaaccccgggctatcctcaaaccccgaaaa
gtgtgcgtcgggggcaagcgaagaaaagatgagatcagtgttgacagtctggactttagc
aaaaagatcttgcatacagcttggcatccttcagaaaacattatagcagtggcggctacg
aataacttatatatattccaggacaaggttaactag

KEGG   Mus caroli (Ryukyu mouse): 110294530
Entry
110294530         CDS       T05910                                 

Gene name
Ppp2r2c
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110294530 (Ppp2r2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110294530 (Ppp2r2c)
   04071 Sphingolipid signaling pathway
    110294530 (Ppp2r2c)
   04151 PI3K-Akt signaling pathway
    110294530 (Ppp2r2c)
   04152 AMPK signaling pathway
    110294530 (Ppp2r2c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110294530 (Ppp2r2c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110294530 (Ppp2r2c)
  09156 Nervous system
   04728 Dopaminergic synapse
    110294530 (Ppp2r2c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110294530 (Ppp2r2c)
   05165 Human papillomavirus infection
    110294530 (Ppp2r2c)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110294530 (Ppp2r2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110294530 (Ppp2r2c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110294530 (Ppp2r2c)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110294530 (Ppp2r2c)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110294530 (Ppp2r2c)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110294530 (Ppp2r2c)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110294530 (Ppp2r2c)
SSDB
Other DBs
NCBI-GeneID: 110294530
NCBI-ProteinID: XP_021018489
Ensembl: MGP_CAROLIEiJ_G0027165
UniProt: A0A6P5PKM4
LinkDB
Position
5
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgacagaagctgacgtcatctccactgtcgagttcaaccacactggggaactgctcgcc
acaggtgacaagggtggcagggtggttatcttccagcgggaaccagagagtaagaacgca
cctcacagccagggtgagtacgatgtatacagcaccttccagagccacgagccggagttt
gactacctgaagagcctggagatagaggagaaaatcaacaagatcaaatggctcccgcag
cagaatgccgcgcactcactgctgtccaccaatgataaaactattaaattatggaagatt
accgaacgagacaagaggcccgagggctacaacctgaaggatgaggagggaaagctgaag
gacctgtccacggtgacgtcactgcaggtgcctgtgctgaagcccatggacctgatggtg
gaggtgagcccaagaaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagcgactgtgagacttacatgtcagcggacgacctacgcatcaacctctggcat
ctggccatcactgatcggagcttcaacatcgtagacatcaagccagccaacatggaggac
ctcacggaggtgatcacagcatctgagttccatccgcaccactgcaacctctttgtctac
agcagcagcaagggctccctgcggctctgtgacatgcgggcagctgccttgtgcgacaag
cactccaagctcttcgaagagcccgaggaccccagcaaccgctccttcttttcagagatc
atctcctcggtatccgacgtgaagttcagccacagtgggcgctacatgctcacgagggat
tacctcacggtcaaggtctgggacctgaacatggaggcgaggcccatagagacctaccag
gtccacgactacctgcggagtaagctctgctccctgtatgagagtgactgcatcttcgac
aagtttgagtgtgcctggaacgggagtgacagtgtcatcatgacaggggcctacaacaac
ttcttccgcatgttcgaccgtaacaccaagcgggatgtgacgctggaggcctcaagggag
agcagcaaacccagagcggtgctcaagccaaggcgtgtgtgtgtgggtggcaagcggcgg
cgtgacgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccagccgagaatatcattgccattgcagccaccaacaacctgtacatcttccaggat
aaggtcaactctgacatgcactag

KEGG   Mus caroli (Ryukyu mouse): 110298725
Entry
110298725         CDS       T05910                                 

Gene name
Ppp2r2d
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110298725 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110298725 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    110298725 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    110298725 (Ppp2r2d)
   04152 AMPK signaling pathway
    110298725 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110298725 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110298725 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    110298725 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110298725 (Ppp2r2d)
   05165 Human papillomavirus infection
    110298725 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110298725 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110298725 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110298725 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110298725 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110298725 (Ppp2r2d)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110298725 (Ppp2r2d)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110298725 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 110298725
NCBI-ProteinID: XP_021023792
Ensembl: MGP_CAROLIEiJ_G0030610
UniProt: A0A6P5Q338
LinkDB
Position
7
AA seq 453 aa
MAGAGGGGCPAGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggcggcggctgcccggcgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagccgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaacaggggacaaaggtggcagagttgttatc
ttccaacgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgggataaaagagcagaaggttat
aacttgaaagatgaagatggacgacttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagccagctaatatggaggagctgacagaagtcatcactgccgcagagttc
cacccacatcagtgcaatgtattcgtctacagcagcagcaaggggaccatcagactgtgc
gacatgcgttcctctgccctatgtgacaggcatgccaagttttttgaagagccagaagat
cccagcagtagatcctttttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgactagagactatctgtcggtgaaggtctgggacctcaac
atggagggcaggcctgtggagacccaccaggtacatgagtacctgcgaagcaagctctgc
tccttgtatgagaatgactgcatctttgacaagttcgagtgctgctggaacggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatgttacactggaagcctcaagagagaacagcaaaccccgagccagcctgaagccc
cggaaagtatgtacagggggtaagagaaagaaagacgagattagtgtggacagtttggac
ttcaataagaagatcctccacacagcctggcaccccatggagagcatcattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

KEGG   Mus caroli (Ryukyu mouse): 110299736
Entry
110299736         CDS       T05910                                 

Gene name
Ppp2cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04136  Autophagy - other
mcal04140  Autophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110299736 (Ppp2cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110299736 (Ppp2cb)
   04390 Hippo signaling pathway
    110299736 (Ppp2cb)
   04071 Sphingolipid signaling pathway
    110299736 (Ppp2cb)
   04151 PI3K-Akt signaling pathway
    110299736 (Ppp2cb)
   04152 AMPK signaling pathway
    110299736 (Ppp2cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110299736 (Ppp2cb)
   04136 Autophagy - other
    110299736 (Ppp2cb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110299736 (Ppp2cb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110299736 (Ppp2cb)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110299736 (Ppp2cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    110299736 (Ppp2cb)
   04730 Long-term depression
    110299736 (Ppp2cb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110299736 (Ppp2cb)
   05165 Human papillomavirus infection
    110299736 (Ppp2cb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110299736 (Ppp2cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110299736 (Ppp2cb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110299736 (Ppp2cb)
   04131 Membrane trafficking [BR:mcal04131]
    110299736 (Ppp2cb)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110299736 (Ppp2cb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110299736 (Ppp2cb)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110299736 (Ppp2cb)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     110299736 (Ppp2cb)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110299736 (Ppp2cb)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110299736 (Ppp2cb)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110299736 (Ppp2cb)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110299736 (Ppp2cb)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 110299736
NCBI-ProteinID: XP_021025193
Ensembl: MGP_CAROLIEiJ_G0030965
UniProt: A0A6P5Q0M2
LinkDB
Position
8
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtggagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaacg
aaagaatcaaatgtgcaagaggtccgctgtcctgttactgtctgtggagatgtgcatggc
caattccatgaccttatggaactcttcagaattggtgggaaatcaccagatacgaactac
ctattcatgggggactatgtagacagaggatattactctgtggagactgtgactcttctt
gtagcattaaaggtgcgctatccagagcgcatcacaatattgcgaggaaatcacgaaagc
cgacagatcacacaagtgtatggcttttatgatgagtgcctacggaagtatggaaatgcc
aacgtgtggaaatactttacagatctctttgattatcttccgcttacagctttagtagat
ggacagatattctgcctccacggtggcctgtctccatccatagatacactggaccacata
agagccctggatcgcttgcaagaagttccacatgagggcccaatgtgtgatctcttatgg
tcagatccggatgaccgtggcggctggggcatttctccacgtggtgctggctatacattt
ggacaagacatttctgaaacgtttaaccatgccaacggtctcacactggtgtctcgtgct
caccagctcgtaatggaaggatataactggtgccatgatcgaaatgtggtcaccattttt
agtgcgcccaattactgctaccgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattcgtttcttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcactccagactacttcctgtaa

KEGG   Mus caroli (Ryukyu mouse): 110302129
Entry
110302129         CDS       T05910                                 

Gene name
Ppp2r1b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110302129 (Ppp2r1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110302129 (Ppp2r1b)
   04390 Hippo signaling pathway
    110302129 (Ppp2r1b)
   04071 Sphingolipid signaling pathway
    110302129 (Ppp2r1b)
   04151 PI3K-Akt signaling pathway
    110302129 (Ppp2r1b)
   04152 AMPK signaling pathway
    110302129 (Ppp2r1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110302129 (Ppp2r1b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110302129 (Ppp2r1b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110302129 (Ppp2r1b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110302129 (Ppp2r1b)
   04730 Long-term depression
    110302129 (Ppp2r1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110302129 (Ppp2r1b)
   05165 Human papillomavirus infection
    110302129 (Ppp2r1b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110302129 (Ppp2r1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110302129 (Ppp2r1b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110302129 (Ppp2r1b)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110302129 (Ppp2r1b)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110302129 (Ppp2r1b)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110302129 (Ppp2r1b)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110302129 (Ppp2r1b)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 CLASP_N M11L AEP1
Other DBs
NCBI-GeneID: 110302129
NCBI-ProteinID: XP_021028575
Ensembl: MGP_CAROLIEiJ_G0032199
UniProt: A0A6P5QFU7
LinkDB
Position
9
AA seq 667 aa
MAGAAGPGSGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKTEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSQEDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKIALSDLIPAFQ
SLLRDCEAEVRAAAAHKVRELCENLPAEGRETVIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTVLGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGKEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQ
RLRKLDFPVKDSEEPSIPGVDKNLFLRPRGPGEDTGKGPACQLHINTRDTLAQLEIAEAM
HFPQNRE
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcgggcgcagcagggccagggtccggtccgggggcagcgggtggagatggagacgat
tcgctctacccgatcgcggttttaatcgacgagctccgcaatgaggacgtgcagctccgt
ctcaacagtattaagaagttatcaactatagctctagcactcggggtagaaaggactcga
acggaactgctgcctttccttacagatactatttatgatgaagatgaggtgctgttagct
cttgccgagcagctgggaaatttcactggtttggtgggcggtcctgactttgcccactgt
ttgctgcctcctttggaaagtttggctacggtggaggagactgtcgttcgagacaaggct
gtggaatcgctgaggcagatctcgcaggagcacactcctgttgcccttgaagctcatttt
gtgcctctggtgaagcgcctggcaagcggggactggttcacgtcgcgcacgtctgcatgt
ggcttgttcagcgtttgctatcccagagcttcaaatgctgtcaaggcagagattcgacag
cacttccgttctctctgctcggatgatacaccaatggtgcgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaactgaaattgttccattg
ttcacgaatttggcttcagatgaacaggactctgtgcggctgctagctgtggaagcctgt
gtcagcattgcccagttactgtctcaggaggacctggaagccttggtaatgcctacactt
cgacaagcagcagaagataaatcctggcgggttcgatatatggtggcagacaaattttca
gagctccagaaagcggtgggccctaagattgcgctcagtgacctcatccccgccttccag
agccttctccgagactgcgaagctgaagtccgagcagccgctgcccacaaagtaagagag
ctttgtgagaacctgcccgctgaaggtagagagactgtaattatgaatcaaatcctgccc
tatataaaggaattagtgtctgataccaaccaacatgtcaagtcagcgctagcttctgta
attatgggattatctacagtgttgggcaaagagaataccattgaacatcttctgcctctg
tttttagctcagttaaaggatgagtgtccagaagttcgtttaaatatcatctccaatttg
gattgtgtgaatgaagtgattggaatccgtcagctctctcagtctctccttccggccata
gtggaactggctgaagatgccaagtggagggtccgcctggctatcattgagtacatgccg
ctgctggctggccagctgggtgtggagttctttgatgaaaaactcaattctttgtgtatg
gcctggcttgtggatcatgtctatgccattcgggaggcagccaccaacaacctcatgaag
ttagtccagaagttcggcacagagtgggctcagaataccattgtccctaaagtgttggta
atggcaaatgaccctaactacttacacagaatgaccactctcttctgcattaatgcactg
tctgaagcctgtggtaaggaaataaccactaagcaaatgttgcccatcgtgttgaaaatg
gcaggagaccaggtagcaaatgtccgcttcaatgtggccaaatcactgcagaaaattgga
ccgattctagacaccaacgccttgcagggggaagtgaagccggtgctgcagaaattaggt
caggacgaagacatggatgtcaaatattttgcacaggaagctataagtgtggtggcacaa
aggctgaggaagctagattttcctgtgaaggacagtgaagagcccagcatccctggggtt
gacaagaatctcttcctgagaccccgagggcctggagaggacactgggaagggaccagca
tgtcagttgcatataaatactagagacacacttgcccaactggaaattgcagaagcaatg
catttcccccaaaacagagagtaa

KEGG   Mus caroli (Ryukyu mouse): 110305092
Entry
110305092         CDS       T05910                                 

Gene name
Ppp2ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04136  Autophagy - other
mcal04140  Autophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110305092 (Ppp2ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110305092 (Ppp2ca)
   04390 Hippo signaling pathway
    110305092 (Ppp2ca)
   04071 Sphingolipid signaling pathway
    110305092 (Ppp2ca)
   04151 PI3K-Akt signaling pathway
    110305092 (Ppp2ca)
   04152 AMPK signaling pathway
    110305092 (Ppp2ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110305092 (Ppp2ca)
   04136 Autophagy - other
    110305092 (Ppp2ca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110305092 (Ppp2ca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110305092 (Ppp2ca)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110305092 (Ppp2ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    110305092 (Ppp2ca)
   04730 Long-term depression
    110305092 (Ppp2ca)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110305092 (Ppp2ca)
   05165 Human papillomavirus infection
    110305092 (Ppp2ca)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110305092 (Ppp2ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110305092 (Ppp2ca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110305092 (Ppp2ca)
   04131 Membrane trafficking [BR:mcal04131]
    110305092 (Ppp2ca)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110305092 (Ppp2ca)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110305092 (Ppp2ca)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110305092 (Ppp2ca)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     110305092 (Ppp2ca)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110305092 (Ppp2ca)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110305092 (Ppp2ca)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110305092 (Ppp2ca)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110305092 (Ppp2ca)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 110305092
NCBI-ProteinID: XP_021032533
Ensembl: MGP_CAROLIEiJ_G0016323
UniProt: A0A6P5QNM3
LinkDB
Position
11
AA seq 309 aa
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
XALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaagttgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgttcaagaggttcgatgtccagtcactgtgtgtggagatgtacatggg
caatttcatgatctcatggaactctttagaattggtggtaaatcaccagatacaaattac
ctgtttatgggagactatgtggacagaggatattactctgttgaaacagttacactgctt
gtagctcttaaggttcgttaccgagagcgtatcaccatactccgagggaatcacgagagc
agacagatcacacaggtttatgggttctacgatgagtgtttaaggaaatacggaaatgca
aatgtttggaaatacttcacagacctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtgggctgtcaccatccatagacacactggatcacatc
cncgcacttgatcgcctacaagaagttcctcatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggctgggggatatctcctcggggagctggttataccttt
ggccaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtccagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacaattttc
agtgctccaaactattgctatcgttgtggtaaccaagctgcaatcatggaacttgacgac
actcttaagtattctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtc
actcgtcgtaccccagactacttcctgtaa

KEGG   Mus caroli (Ryukyu mouse): 110309355
Entry
110309355         CDS       T05910                                 

Gene name
Ppp2r2a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110309355 (Ppp2r2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110309355 (Ppp2r2a)
   04071 Sphingolipid signaling pathway
    110309355 (Ppp2r2a)
   04151 PI3K-Akt signaling pathway
    110309355 (Ppp2r2a)
   04152 AMPK signaling pathway
    110309355 (Ppp2r2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110309355 (Ppp2r2a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110309355 (Ppp2r2a)
  09156 Nervous system
   04728 Dopaminergic synapse
    110309355 (Ppp2r2a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110309355 (Ppp2r2a)
   05165 Human papillomavirus infection
    110309355 (Ppp2r2a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110309355 (Ppp2r2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110309355 (Ppp2r2a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110309355 (Ppp2r2a)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110309355 (Ppp2r2a)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110309355 (Ppp2r2a)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110309355 (Ppp2r2a)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110309355 (Ppp2r2a)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 110309355
NCBI-ProteinID: XP_021037626
Ensembl: MGP_CAROLIEiJ_G0019446
UniProt: A0A6P5QZX4
LinkDB
Position
14
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgacgtagcagaagcagatataatttctacagtagagtttaatcattctgga
gaattactagccacaggagataaaggtgggagagttgtcatctttcaacaagagcaggag
aacaaaatccagtctcatagcagaggagaatacaatgtttacagcaccttccagagccat
gagccagaatttgactacttgaaaagcttagaaatagaagagaagatcaacaaaattagg
tggttaccccagaaaaatgctgcccagtttttattgtctaccaacgataaaacaataaaa
ttatggaaaatcagtgaaagagacaaaagaccagaaggctataacttgaaagaggaagat
ggaagatatagagatcctactacagtcactacgctacgggtgcccgtatttaggcccatg
gatctaatggtggaagccagtccacggagaatatttgccaacgcccacacttatcacatc
aactcaatttctatcaatagtgattatgaaacctacttatcagcagatgatttgcgaatt
aatctctggcatctggaaattacagacaggagttttaatattgtggatatcaagcctgcc
aatatggaagagctcacggaggtgatcacagctgcagaatttcaccccaacagctgtaac
acgtttgtgtacagcagcagtaaaggaaccattcggttatgtgacatgagggcatctgcg
ctctgtgacaggcattcgaaactgtttgaagaacctgaagatcccagcaacaggtcattt
ttttctgaaatcatctcctctatttctgatgtaaaattcagccatagtggtcgttatatg
atgactagagactatttgtcagtcaaaatttgggacttgaatatggagaacaggcccgtg
gagacataccaggtacatgaatacctcagaagtaaactttgctcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatgggtctgacagtgttgtcatgactgga
tcctacaataatttcttcagaatgttcgacaggaacacaaagagggatataaccctagaa
gcatcacgagagaacaataagcctcgcacggttttgaagccacgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaacaagaaaatcctt
catacagcctggcatcccaaggaaaacatcattgctgtagcgactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Mus caroli (Ryukyu mouse): 110312643
Entry
110312643         CDS       T05910                                 

Gene name
Ppp2r1a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal05142  Chagas disease
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110312643 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110312643 (Ppp2r1a)
   04390 Hippo signaling pathway
    110312643 (Ppp2r1a)
   04071 Sphingolipid signaling pathway
    110312643 (Ppp2r1a)
   04151 PI3K-Akt signaling pathway
    110312643 (Ppp2r1a)
   04152 AMPK signaling pathway
    110312643 (Ppp2r1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110312643 (Ppp2r1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110312643 (Ppp2r1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312643 (Ppp2r1a)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312643 (Ppp2r1a)
   04730 Long-term depression
    110312643 (Ppp2r1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110312643 (Ppp2r1a)
   05165 Human papillomavirus infection
    110312643 (Ppp2r1a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110312643 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110312643 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110312643 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110312643 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110312643 (Ppp2r1a)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110312643 (Ppp2r1a)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110312643 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 110312643
NCBI-ProteinID: XP_021042075
Ensembl: MGP_CAROLIEiJ_G0021123
UniProt: A0A6P5RAF4
LinkDB
Position
17
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcagctgccgacggtgacgattcgctctatcctattgcggtgctcatagatgaactc
cgcaatgaggacgttcagcttcgtctcaatagtatcaagaagctctccacgattgccttg
gcccttggagttgaacggaccagaagtgagctcctgcccttccttacagataccatttat
gatgaagatgaggtcctcttggccttggctgaacagctgggaaccttcacaactttggtg
ggagggcctgagtatgtgcactgtctgctgccaccccttgagtcactggccacagtggaa
gaaacagtagtgcgagacaaggcggtagaatccctgcgggccatctctcatgagcactca
ccttccgatctagaggctcactttgtgcctctggtaaagcggctggcgggtggagactgg
ttcacctcccgcacctcggcctgtggtctcttctcagtttgctacccccgagtatccagt
gccgtgaaggcagaacttcgacagtacttccggaacctgtgctcagatgacactcccatg
gtgcggcgggccgctgcctccaagctgggggaatttgccaaggtgctggagctggacaat
gtcaagagtgagatcattcccatgttctctaacctggcctctgacgagcaggactcggtg
cggctgctggcagtggaggcatgtgtgaatattgcccagcttctgccacaggaggacctg
gaggccttagtgatgcccaccttgcgacaggctgctgaggacaagtcttggcgtgttcgc
tacatggtggccgataagttcacagagctccagaaagcagtgggacctgagatcaccaag
acagatctggtgcctgccttccagaacctgatgaaggactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagaattctgtgaaaatctctcagctgactgccgggagaat
gtgatcatgactcagatcttgccctgcatcaaggagcttgtgtcagatgccaaccaacat
gtcaagtcagcattggcttcagtcatcatgggcctctctcccattctgggcaaagacaac
accatcgaacacctcttgcccctgttcttggctcagctgaaggatgagtgtcctgaagtc
cgactgaatatcatctccaacctggattgtgtgaacgaggtgattggcatcaggcagctc
tctcagtccctgcttcctgccatcgtggaactagctgaagatgccaagtggcgagtgcgg
ctggccatcattgaatacatgcctctgctggctggacagcttggtgtggaattttttgat
gagaaactaaactctttgtgtatggcctggctagtggatcatgtctatgctatccgtgag
gctgccaccagcaaccttaagaagttagtagagaagttcgggaaggagtgggcccatgcc
actatcatccccaaggtcttagccatgtctggagaccctaactacctgcaccgaatgact
acactcttctgcatcaatgtattgtctgaggtctgtgggcaggatatcaccaccaagcac
atgctgcccacagttcttcgtatggctggggacccagtcgccaatgtccgcttcaatgtg
gccaagtcactacagaagataggacccattcttgataacagcaccctgcagagtgaagtc
aagcccatcctggagaaactgacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctctgactgttctctctcttgcctga

DBGET integrated database retrieval system