KEGG   Mus caroli (Ryukyu mouse): 110284497
Entry
110284497         CDS       T05910                                 

Gene name
Smad2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04144  Endocytosis
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04659  Th17 cell differentiation
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05142  Chagas disease
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110284497 (Smad2)
   04390 Hippo signaling pathway
    110284497 (Smad2)
   04371 Apelin signaling pathway
    110284497 (Smad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110284497 (Smad2)
  09143 Cell growth and death
   04110 Cell cycle
    110284497 (Smad2)
   04218 Cellular senescence
    110284497 (Smad2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110284497 (Smad2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110284497 (Smad2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110284497 (Smad2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284497 (Smad2)
   05205 Proteoglycans in cancer
    110284497 (Smad2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284497 (Smad2)
   05212 Pancreatic cancer
    110284497 (Smad2)
   05225 Hepatocellular carcinoma
    110284497 (Smad2)
   05226 Gastric cancer
    110284497 (Smad2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110284497 (Smad2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110284497 (Smad2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110284497 (Smad2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110284497 (Smad2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 110284497
NCBI-ProteinID: XP_021005909
Ensembl: MGP_CAROLIEiJ_G0022410
UniProt: A0A6P7QF37
LinkDB
Position
18
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagtggtgaagagacttctgggatggaaaaaa
tcagccggtgggtctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgaaaaagcagtgaaaagtctggtgaaaaagctaaagaaaacaggacggttagatgag
cttgagaaagccatcaccactcagaattgcaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacagcaaatacggtagatcagtgggacacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggccgacttcaggtttcacaccgg
aaagggttgccacatgttatatattgccggctctggcgctggccggaccttcacagtcat
catgagctcaaggcaatcgaaaactgcgaatatgcttttaatctgaaaaaagatgaagta
tgtgtaaatccttaccactaccagagagttgagacaccagtcttgcctccagtcttagtg
cctcggcacacagagattctaacagaactgccacctctggatgactacacccactccatt
ccagaaaacacaaatttcccagcaggaattgagccacagagtaattacatcccagaaaca
ccaccacctggatatatcagtgaagatggagaaacaagtgaccagcagttgaaccaaagt
atggacacaggctctccggctgaactgtctcctactactctctctcctgttaatcacagc
ttggatttgcagccagttacttactcggaacctgcgttctggtgttcaatcgcatactat
gaactaaaccagagggttggagagaccttccatgcgtcacagccctcgctcactgtagac
ggcttcacagacccatcaaactcggagaggttctgcttaggcttgctctccaacgttaac
cgaaatgccactgtagaaatgacaagaaggcatataggaaggggagtgcgcttgtattac
ataggtggggaagtgtttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaaccagagatacggctggcaccctgcaacagtgtgtaagatcccaccaggctgt
aacctgaagatcttcaacaaccaagaatttgctgctcttctggctcagtctgtcaaccag
ggttttgaagccgtttatcagctaacccgaatgtgcaccataagaatgagttttgtgaag
ggctggggagcggaatatcggaggcagacagtaacaagtactccttgctggattgaactt
catctgaacggccctctgcagtggttggacaaagtattaactcagatgggatccccttca
gtgcgatgctcaagcatgtcgtaa

KEGG   Mus caroli (Ryukyu mouse): 110301346
Entry
110301346         CDS       T05910                                 

Gene name
Smad3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04144  Endocytosis
mcal04218  Cellular senescence
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04659  Th17 cell differentiation
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110301346 (Smad3)
   04350 TGF-beta signaling pathway
    110301346 (Smad3)
   04390 Hippo signaling pathway
    110301346 (Smad3)
   04371 Apelin signaling pathway
    110301346 (Smad3)
   04068 FoxO signaling pathway
    110301346 (Smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110301346 (Smad3)
  09143 Cell growth and death
   04110 Cell cycle
    110301346 (Smad3)
   04218 Cellular senescence
    110301346 (Smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110301346 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110301346 (Smad3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110301346 (Smad3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301346 (Smad3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301346 (Smad3)
   05212 Pancreatic cancer
    110301346 (Smad3)
   05225 Hepatocellular carcinoma
    110301346 (Smad3)
   05226 Gastric cancer
    110301346 (Smad3)
   05220 Chronic myeloid leukemia
    110301346 (Smad3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110301346 (Smad3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110301346 (Smad3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301346 (Smad3)
   05161 Hepatitis B
    110301346 (Smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 110301346
NCBI-ProteinID: XP_021027456
Ensembl: MGP_CAROLIEiJ_G0032335
UniProt: A0A6P5QHT4
LinkDB
Position
9
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggttggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagttagacgagctggagaaggccatcaccacgcagaacgtg
aacaccaagtgcattaccatccccaggtcactagatggccggttgcaggtgtcccatcgg
aaggggctccctcacgttatctactgccgcctgtggcgatggcccgacctgcacagccac
catgaattacgggccatggagctctgtgagttcgccttcaacatgaagaaggatgaagtg
tgtgtaaatccttaccactatcagagagtagagacgccagttctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttccccccactggatgactacagccattccatt
cccgagaacactaacttccctgctggcattgagccccagagcaatattccagaaacccca
cctcctggctacctgagtgaagatggagaaaccagcgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtcacctactgtgagcctgccttctggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcctcacagccatccatgacagtagatggcttc
actgacccctccaactcggagcgcttctgtctgggcctgctgtccaatgtcaaccggaat
gcagccgtggaacttacgaggcgacacatcgggagaggtgtgcggctctactacatcgga
ggggaggtctttgcggagtgcctcagtgacagtgctattttcgtccagtctcccaactgc
aaccagcgctatggctggcacccggccactgtctgcaagatcccaccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgcccttctagctcagtctgtcaaccagggcttt
gaggctgtctaccagctgacgcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagacagtgaccagcaccccctgctggattgagctacacctg
aacgggcccttgcagtggcttgacaaggtcctcacccagatgggttccccgagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system