KEGG   Mus caroli (Ryukyu mouse): 110284498
Entry
110284498         CDS       T05910                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04340  Hedgehog signaling pathway
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110284498 (Csnk1a1)
   04340 Hedgehog signaling pathway
    110284498 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110284498 (Csnk1a1)
   05226 Gastric cancer
    110284498 (Csnk1a1)
   05224 Breast cancer
    110284498 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284498 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    110284498 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284498 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110284498 (Csnk1a1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110284498 (Csnk1a1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110284498 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 110284498
NCBI-ProteinID: XP_021005911
Ensembl: MGP_CAROLIEiJ_G0022325
UniProt: A0A6P5NVD8
LinkDB
Position
18
AA seq 374 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGIKDEKLDPLS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtgggaaatacaaactggtg
cggaagatcggatctggctcttttggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataacgtgctagtcatggatctcctgggacccagcctcgaagacctc
ttcaacttctgttcaaggaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatatgccagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccgtggcaaggactgaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggtgttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacgatgttaaagcagaaagcagcccagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtattaaagacgagaagttggatccactgagttag

DBGET integrated database retrieval system