KEGG   Mus caroli (Ryukyu mouse): 110284527
Entry
110284527         CDS       T05910                                 

Gene name
Nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110284527 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110284527 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110284527 (Nr3c1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110284527 (Nr3c1)
Nuclear receptors [BR:mcal03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110284527 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 110284527
NCBI-ProteinID: XP_021005960
Ensembl: MGP_CAROLIEiJ_G0022216
LinkDB
Position
18
AA seq 787 aa
MDSKESLAPPGRDEVPSSLLGRGRGSVMDFYKTLRGGATVKVSAPSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQQQQQPPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQG
QLGLSSGETDFRLLEESIANLNRSTSLPENPKSSTPAAGCATPTEKEFPQTHSDPSSEQQ
NRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDENLLSPLA
GEDDPFLLEGDANEDCKPLILPDTKPKIQDTGDTVLSSPSSVALPQVKTEKDDFIELCTP
GVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKP
VFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFPGRSVFSNGYSSPGMRPDVSSPPSSS
STATGPPLKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIR
RKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTP
TLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLD
DQMTLLQYSWMFLMAFALGWRSYRQASGSLLCFAPDLIINEQRMTLPCMYDQCKHMLFIS
TELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQ
NWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIK
KLLFHQK
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggactccaaagaatccttagctccccctggtagagacgaagtccccagcagtttgctt
ggccgggggaggggaagcgtgatggacttttataaaaccctgaggggaggagctacagtc
aaggtttctgcgccttcaccctcagtggctgctgcttctcaggcagattccaagcagcag
aggattctccttgatttttcaaaaggctcagcaagcaatgcgcagcagcagcagcagcag
cagcagcagcagcagcagccgccagatttatccaaagccgtttcactgtccatgggactg
tatatgggagagaccgaaacaaaagtgatggggaatgacttgggctacccacagcagggc
cagcttggcctctcttctggggaaacagactttcggcttctggaagaaagcattgcaaac
ctcaataggtcgaccagccttcccgagaaccccaagagttcaacacctgcagcggggtgt
gctaccccgacagagaaggagtttccccagactcactctgatccatcttcagaacagcaa
aatagaaaaagccagcccggcaccaacggtggcagtgtgaaattgtataccacagaccaa
agcacctttgacatcttgcaggatttggagttttctgccgggtccccaggtaaagagaca
aacgagagtccttggaggtcagacctgttgatagatgaaaacttgctttctcctttggcg
ggagaagatgatccattccttctggaaggggacgcgaatgaggattgcaagcctcttatt
ttaccggacactaaacctaaaattcaggatactggagatacagtcttatcaagccccagc
agtgtggcactgccccaagtgaaaacagagaaagatgatttcattgaactttgcacccct
ggggtaattaagcaagagaaactgggcccagtttattgccaggcaagcttttctgggaca
aatataattgggaataaaatgtctgccatttctgttcatggcgtgagtacctctggagga
cagatgtaccactatgacatgaatacagcatccctttctcagcagcaggatcagaagcct
gtttttaatgtcattccacccattcccgttggttctgaaaactggaataggtgccaaggg
tctggagaggacaacctgacttccttgggggctatgaacttcccaggccgctcagtgttt
tctaatggatattcaagccctggaatgagaccagatgtgagctctcctccgtccagctcc
tccacagcaacgggaccacctctcaaactctgcctggtgtgctccgatgaagcttcggga
tgccattatggggtgctgacgtgtggaagctgtaaagtcttctttaaaagagcagtggaa
ggtagacagcacaattacctttgtgctgggagaaatgattgcatcattgataaaattcga
agaaaaaactgtccagcatgccgctatcgaaaatgtcttcaagctggaatgaacctggaa
gctcgaaaaacgaagaaaaaaattaaaggaattcagcaagccactgcaggagtctcacaa
gacacttctgaaaaccctaacaaaacaatagttcctgccgcgttaccacagctgacccct
accttggtgtcactgctggaggtgattgagcctgaggtgttatacgcaggatatgacagc
tctgttccagactcagcatggagaattatgaccacgctcaacatgttaggtgggcgccaa
gtgattgccgcagtgaaatgggcaaaggcgataccaggattcagaaacttacacctggat
gaccaaatgacccttctacagtactcatggatgtttctcatggcctttgccctgggttgg
agatcatacagacaagcaagtggaagcctgctatgctttgctcctgatctgattattaat
gagcagagaatgactctaccctgcatgtatgaccaatgtaaacacatgctgtttatctcc
actgagttacaaagattgcaagtgtcctatgaagagtatctctgtatgaaaaccttactg
cttctctcctcagttcctaaggaaggtctgaagagccaagagttatttgatgagattcga
atgacttatatcaaagagctaggaaaagccattgtcaaaagggaaggaaactccagtcag
aattggcagcggttttatcaactgacaaaacttttggactccatgcatgatgtggttgaa
aatctccttagctactgcttccagacatttttggataagtccatgagtattgaattccca
gagatgttagctgaaatcatcactaatcagataccaaaatactcaaatggaaatatcaaa
aagcttctgttccatcagaaatga

DBGET integrated database retrieval system