KEGG   Mus caroli (Ryukyu mouse): 110284617Help
Entry
110284617         CDS       T05910                                 

Gene name
Cndp1
Definition
(RefSeq) beta-Ala-His dipeptidase
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00330  Arginine and proline metabolism
mcal00340  Histidine metabolism
mcal00410  beta-Alanine metabolism
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110284617 (Cndp1)
   00340 Histidine metabolism
    110284617 (Cndp1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110284617 (Cndp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcal01002]
    110284617 (Cndp1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     110284617 (Cndp1)
Peptidases [BR:mcal01002]
 Metallo Peptidases
  Family M20
   110284617 (Cndp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 110284617
NCBI-ProteinID: XP_021006049
Ensembl: MGP_CAROLIEiJ_G0022450
LinkDB All DBs
Position
18
AA seq 493 aa AA seqDB search
MFSSSPHSGLLEKLFQYIDLHQDEFVQTLKEWVSIESDSVQPVPRLRQKLFQMMALAADK
LRNLGARVDSVDLGSQQMPDGQSLPIPPILLAELGNDPKKPTVCFYGHLDVQPAQKDDGW
LTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKLILEGMEEAGSV
ALEELVKREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGT
FGGILNEPMADLVTLLGSLVDSSGHILIPGIYDQMAPITEEEKTMYENIDMDLEEYQNIN
QVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMTPS
VVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANIHDTQYLAAQRAIKTVFEVDPDM
IRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELS
KQHSGHQMPSSVF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttctcctcttcgccacactctgggctgttggagaagcttttccagtacatagacctc
caccaggatgagttcgtgcagacactgaaggagtgggtgtccattgagagtgattctgtg
cagcctgtgcctcgtctcagacagaagctcttccagatgatggccttggctgcagacaaa
ctccggaacctgggagctagggtggattccgtagacttgggttctcagcagatgcctgat
ggtcagagtctccccatacctcctatcctattggccgagctgggaaatgatcccaagaag
ccaactgtatgcttctatgggcacctggacgtgcaaccagctcagaaggacgacgggtgg
ctcacggacccctacacactgacagaggtggatgggaaactgtatggacggggagcaaca
gacaacaaaggccccgtcttggcttggatcaatgccgtgagcaccttcagagctctgcag
caggatcttcccgtgaacatcaagctcatcctggaggggatggaagaagctggctctgtc
gcgctggaggaactcgtcaagagagaaaaggaccacttcttctccagtgtggactacatt
gtgatttcagacaacctgtggctcagccagaggaaacctgcactcacttatggaacccgg
gggaactgctacttcaccgtggaggtgaagtgtagagatcaagatttccactcaggaacc
tttggtggcatcctcaacgaaccaatggctgacttggttactcttctaggtagcctggtg
gattcatcaggccacatcctaattcctggaatctatgaccaaatggcaccgattacagag
gaagaaaagacaatgtatgaaaacattgatatggacctagaagaataccagaacatcaac
caagtcgagaaatttctgtttgataccaaggaggaactcctgatgcatctgtggaggtat
ccgtctctctccatccatggcattgagggtgcgttcgatgagcctggaactaaaacggtc
attcccggcagagtcctaggaaaattttcaatccgtctcgtccctaccatgactccgtct
gtggtggagaaacaggtaactcagcatctcgaagctgtcttctctaaaaggaatagtttc
aacaagatggccgtttctatggtactaggactccacccatggactgcaaacatccatgat
actcagtaccttgcagcacagagagccatcaaaacagtgtttgaagttgatcctgacatg
atccgggatgggtcaaccattccaattgccaaaatattccaggctatcacacaaaagagc
gtgatgatgctgccgctgggagctgtggacgatggagagcattctcagaatgagaagatc
aacaggtggaactacatacaggggtcgaaattattcgctgcctttttcctggagttgtca
aaacagcattcaggacaccagatgccttccagtgtcttctga

DBGET integrated database retrieval system