KEGG   Mus caroli (Ryukyu mouse): 110284697
Entry
110284697         CDS       T05910                                 

Gene name
Egr1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04371  Apelin signaling pathway
mcal04912  GnRH signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05020  Prion disease
mcal05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110284697 (Egr1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110284697 (Egr1)
   04928 Parathyroid hormone synthesis, secretion and action
    110284697 (Egr1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110284697 (Egr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110284697 (Egr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110284697 (Egr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110284697 (Egr1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    110284697 (Egr1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-H2C2_5 zf-C2H2_8
Other DBs
NCBI-GeneID: 110284697
NCBI-ProteinID: XP_021006206
Ensembl: MGP_CAROLIEiJ_G0022101
UniProt: A0A6P5P1W5
LinkDB
Position
18
AA seq 533 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGG
NSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPS
QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSS
SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA
TKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTTYSSPGSSTYPSPAHSGF
PSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcagcggccaaggccgagatgcaattgatgtctccgctgcagatctctgacccgttc
ggctcctttcctcactcacccaccatggacaactaccccaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtgctgccggaaccccagagggcagcggcggt
aatagcagcagcagcaccagcagcgggggcggtggtgggggcggcagcaacagcggcagc
agcgccttcaatcctcaaggggagccgagcgaacaaccctatgagcacctgaccacagag
tccttttctgacatcgctctgaataatgagaaggcaatggtggaaacgagttatcccagc
caaacgactcggttgcctcccatcacctataccggtcgcttctccctggagcccgcaccc
aacagtggcaacactttgtggcctgaaccccttttcagcctagtcagtggcctcgtgagc
atgaccaatcctccgacctcttcatcctcggcgccttctccagctgcttcatcgtcttcc
tctgcctcccagagcccgcccctgagctgtgccgtgccgtccaacgacagcagtcccatc
tactcggctgcgcccaccttccctactcccaacactgacatttttcctgagccccaaagc
caggcctttcccggctctgcaggcacagccttgcagtacccgcctcctgcctaccctgcc
accaaaggtggtttccaggttcccatgatccctgactatctgtttccacaacaacaggga
gacctgagcctgggcaccccagaccagaagcccttccagggtctggagaaccgtacccag
cagccttcgctcactccactatccactattaaagccttcgccactcagtcgggctcccag
gacttaaaggctcttaataccacctaccaatcccagctcatcaaacccagccgcatgcgc
aagtaccccaaccggcccagcaagacacccccccatgaacgcccatatgcttgccctgtc
gagtcctgcgatcgccgcttttctcgctcggatgagcttacccgccatatccgcatccac
acaggccagaagcccttccagtgtcgaatctgcatgcgcaacttcagtcgtagtgaccac
cttaccacccacatccgcacccacacaggcgagaagccttttgcctgtgacatttgtggg
agaaagtttgccaggagtgatgaacgcaagaggcataccaaaatccatttaagacagaag
gacaagaaagcagacaaaagtgtggtggcctccccggctgcctcttccctctcttcttac
ccatccccagtggctacctcctacccatcccccgccaccacctcattcccatcccctgtg
cccaccacctactcctctcctggctcctccacctacccatctcctgcacacagtggcttc
ccgtcgccttcggtggccaccacctttgcctcggttccacctgctttccccacccaggtc
agcagcttcccgtctgcaggcgtcagcagctccttcagcacctcaactggtctttcagac
atgacagcgaccttttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system