KEGG   Mus caroli (Ryukyu mouse): 110284745
Entry
110284745         CDS       T05910                                 

Gene name
Fzd8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110284745 (Fzd8)
   04390 Hippo signaling pathway
    110284745 (Fzd8)
   04150 mTOR signaling pathway
    110284745 (Fzd8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110284745 (Fzd8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110284745 (Fzd8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284745 (Fzd8)
   05205 Proteoglycans in cancer
    110284745 (Fzd8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110284745 (Fzd8)
   05226 Gastric cancer
    110284745 (Fzd8)
   05217 Basal cell carcinoma
    110284745 (Fzd8)
   05224 Breast cancer
    110284745 (Fzd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110284745 (Fzd8)
   05022 Pathways of neurodegeneration - multiple diseases
    110284745 (Fzd8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110284745 (Fzd8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284745 (Fzd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110284745 (Fzd8)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110284745 (Fzd8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110284745
NCBI-ProteinID: XP_021006276
Ensembl: MGP_CAROLIEiJ_G0021983
UniProt: A0A6P5NYJ6
LinkDB
Position
18
AA seq 685 aa
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSG
SGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGA
AGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWF
LAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLR
GFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTV
PAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGV
WVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDV
STGLTWRSGTASSVSYPKQMPLSQV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctagccgccttggcggtgctacag
cgctccagcggcgctgccgcggcttcggctaaggagctggcgtgccaagagatcacggtg
ccgttgtgcaaaggcatcggttacaactacacttacatgcccaaccagttcaaccacgac
acgcaagatgaggcgggcctagaggtgcaccagttctggccgctggtggagatacagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaagcctctgccgccttgtcgctctgtttgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcttggcctgaccgcatgcgctgcgatcggttgccggag
cagggcaacccggacactctgtgcatggactacaaccgcaccgacctcaccacagccgcg
cccagcccaccgcgccgcctgcctccgccgcctccgcccggcgagcagccgccctctggc
agcggccacagccgcccgccaggggccaggcccccacatcgtggcggcagcagtaggggc
agcggggacgcggcggctgcgcccccttcgcgcggcgggaaggcgaggccccctggtggc
ggcgctgctccctgcgagccgggatgccagtgccgcgcgcccatggtgagcgtgtccagc
gaacgccaccctctctacaaccgcgtcaagactggccagatcgccaactgtgcgctgccc
tgccacaaccccttctttagccaggatgagcgcgccttcaccgtcttctggatcggcctg
tggtcggtgctctgcttcgtctccaccttcgccactgtctctaccttcctcatcgatatg
gagcgctttaagtacccggaacggcccatcatattcctctccgcctgttacctcttcgtg
tctgtcgggtacctggtgcgcctggtggcaggacatgagaaagtggcctgcagcggcggc
gctccgggtgctggcggagctgggggtgcgggcggcgcggcggcggctggcgcaggggcg
gcgggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagctgggcgcagtc
gagcagcatgtgcgctatgagaccactggccccgcgctgtgcacggtggtctttctcctt
gtctacttttttggcatggctagctccatctggtgggtaatcctgtcgctcacgtggttc
ttggcagctggcatgaagtggggtaacgaggccatagcaggctactcgcagtacttccac
ctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctcagctccgta
gacggagacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgc
ggctttgtgctggcgccactggttatctacctcttcattgggactatgtttctgttagct
ggcttcgtgtcgctgttccgaatccgttcagtcatcaagcagcaaggaggcccaactaag
acacacaagctagaaaaactcatgatccgcttgggcctcttcaccgtgctatacacggtg
cccgctgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccccgctgggag
gccacgcacaactgcccatgccttcgggacctgcaaccggaccaggctcgcaggcccgat
tacgcggtcttcatgctcaagtacttcatgtgcctagtagtgggcatcacatcgggcgtg
tgggtctggtccggcaagactctggagtcctggcgcgcgttgtgcactagatgctgctgg
gccagcaagggcgctgcagtaggcgcgggcgctggaggcagcggccctgggggcagtggc
ccggggcccggcggaggtgggggacacggcggaggcgggggatccctctacagcgacgtc
agtacgggcctgacgtggcggtctggcacggctagctctgtatcttaccctaagcaaatg
ccattgtcccaggtctga

KEGG   Mus caroli (Ryukyu mouse): 110294363
Entry
110294363         CDS       T05910                                 

Gene name
Fzd1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110294363 (Fzd1)
   04390 Hippo signaling pathway
    110294363 (Fzd1)
   04150 mTOR signaling pathway
    110294363 (Fzd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110294363 (Fzd1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110294363 (Fzd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294363 (Fzd1)
   05205 Proteoglycans in cancer
    110294363 (Fzd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110294363 (Fzd1)
   05226 Gastric cancer
    110294363 (Fzd1)
   05217 Basal cell carcinoma
    110294363 (Fzd1)
   05224 Breast cancer
    110294363 (Fzd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110294363 (Fzd1)
   05022 Pathways of neurodegeneration - multiple diseases
    110294363 (Fzd1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110294363 (Fzd1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110294363 (Fzd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110294363 (Fzd1)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110294363 (Fzd1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 110294363
NCBI-ProteinID: XP_021018210
Ensembl: MGP_CAROLIEiJ_G0026943
UniProt: A0A6P5PPI9
LinkDB
Position
5
AA seq 642 aa
MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRADPRRWASGLLLLLWL
LEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKV
YGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAV
AVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVD
ALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYT
VPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMI
KYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggctgaggaggcggcgcctagcgagtcccgggccgccggccggctgagcttggaactt
tgtgccgaagcactcccgggccggcgggaggaggtggggcacgaggacacggccagccac
cgccgcccccgggctgatccccggcgttgggctagcgggctgctgctgctgctttggttg
ctggaggctcctctgcttttgggggtccgagcgcaggcagcgggccaggtatccgggccg
ggccagcaagccccgccgccgccccagccccagcagagcgggcagcagtacaacggcgaa
cggggcatctccatcccggaccacggctactgccagcccatctccatcccgctgtgcacg
gacatcgcgtacaaccagaccatcatgcccaacctgctgggccacacgaatcaggaggac
gccggtctggaggtgcaccagttctaccctctggtgaaggtgcagtgctccgccgagctc
aagttcttcttgtgctccatgtacgcgcctgtgtgcaccgtactggagcaggcgctaccg
ccctgccgctccctgtgcgagcgcgcacgccagggctgcgaggcgctcatgaacaagttc
ggcttccagtggccagacacactcaagtgcgagaagttcccggtgcacggcgcgggagag
ctgtgcgtgggccagaacacgtccgacaaaggcaccccaactccctccttgctaccagag
ttctggaccagcaatccgcagcacggcggcggtggttaccgcggcggctacccggggggt
gccgggacggtggagcggggaaagttctcctgcccgcgcgccctcagggtgccctcctac
ctcaactaccactttctgggggagaaggactgcggcgcaccctgcgaacccactaaggtt
tacgggctcatgtactttgggcccgaggagctgcgcttctcgcgcacctggataggcatc
tggtccgtgctgtgctgcgcctccacgctcttcacggtgctcacgtacctagtggacatg
cggcgcttcagctacccggaacggcccatcattttcctgtccggttgttacacagcggtg
gcggtggcctacatcgccggctttctgttggaggaccgggtggtgtgcaacgacaagttt
gcagaggacggggcgcgcacggtggcgcagggcactaagaaagaaggctgcactatactc
tttatgatgctctacttcttcagcatggccagctccatctggtgggtgatcctgtccctc
acctggttcctggcagcgggcatgaagtggggccacgaagccatcgaggccaactcacag
tatttccatctagctgcctgggctgtgccagccatcaaaactataaccatcttggcgttg
ggccaggtggatggcgacgtactgagcggagtgtgttttgtggggctcaacaacgtagac
gcactgcgtggctttgtgctggcgcctctcttcgtttatctgttcatcggcacttctttc
ctgctggccggtttcgtgtcactcttccgcatccgcaccatcatgaagcatgacggcacc
aagacagagaagctggagaagctcatggtgcgtatcggagtcttcagtgtgctctacacc
gtgccggccaccatcgtcatcgcctgctacttctatgaacaggcctttcgggaccagtgg
gagcgcagctgggtggcccagagctgcaagagttatgccatcccttgccctcacctccag
ggaggtggaggagtcccaccacacccgcccatgagcccggactttacagtcttcatgatc
aagtatctcatgacgctgattgtgggcatcacatcgggcttctggatctggtccggcaag
acactgaattcctggaggaagttctacacgaggcttaccaacagcaaacagggggagact
accgtctga

KEGG   Mus caroli (Ryukyu mouse): 110294401
Entry
110294401         CDS       T05910                                 

Gene name
Fzd5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110294401 (Fzd5)
   04390 Hippo signaling pathway
    110294401 (Fzd5)
   04150 mTOR signaling pathway
    110294401 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110294401 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110294401 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294401 (Fzd5)
   05205 Proteoglycans in cancer
    110294401 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110294401 (Fzd5)
   05226 Gastric cancer
    110294401 (Fzd5)
   05217 Basal cell carcinoma
    110294401 (Fzd5)
   05224 Breast cancer
    110294401 (Fzd5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110294401 (Fzd5)
   05022 Pathways of neurodegeneration - multiple diseases
    110294401 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110294401 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110294401 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110294401 (Fzd5)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110294401 (Fzd5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110294401
NCBI-ProteinID: XP_021018281
Ensembl: MGP_CAROLIEiJ_G0014210
UniProt: A0A6P5PQW7
LinkDB
Position
1
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcgacccgacccgtctgcgcctccctctcttctgctgctgttgctggcgcagctg
gtgggccgggcagcggccgcctccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgaggcatcggctacaacctgacgcacatgcccaaccagttcaaccatgacacgcag
gacgaagcaggcctggaggtgcaccaattctggccgctggtggagatccactgttcaccg
gacctgcgcttcttcctgtgctctatgtacacgcccatctgtttgcctgactaccataag
ccgctaccaccgtgccgttccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccaatacggcttcgcctggcccgagcgcatgagctgcgaccgcctccctgtgctgggc
ggcgacgccgaggttctgtgcatggattataaccgaagcgaagccaccaccgcgtcccct
aagtccttcccggccaaacctacactcccaggaccaccaggggcgccatcttccggaggc
gagtgcccctccggaggcccatccgtgtgcacgtgccgcgagcccttcgtgcccatcctg
aaggagtcacacccactctacaacaaggtgcgcacgggacaagtgcccaactgcgcggtg
ccctgctaccagccgtccttcagcccggacgagcgcacgttcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacgtccaccaccgttgccaccttcctcattgac
atggaacgattccgctaccctgagcgccccatcatcttcttgtctgcgtgctacctgtgt
gtgtcactgggattcttggtgcgcctggtagtgggccatgccagcgtcgcctgcagccgt
gagcatagtcacattcactatgagactaccggccctgcactgtgcacggttgtcttcctc
ttagtctatttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaatgaagccatcgcaggctatgcacagtacttc
caccttgctgcctggctcatccccagtgtcaagtccattacggcgctggcactgagctcg
gtggacggggacccggtggctggcatctgctatgtgggcaaccaaaacctgaactcacta
cgaggctttgtcttgggcccactggtgctgtacctgttggtgggcacgctcttccttctg
gcaggcttcgtgtcactcttccgcatccggagcgtcatcaagcagggtggcactaagacg
gacaagctagagaagctcatgatccgcattggcatcttcactctgctctacacagtgcca
gccagcatcgtggtggcctgctacctgtatgagcagcactaccgggagagctgggaggca
gccctcacctgcgcgtgtccgggaccggacgctggccagccacgcgccaaacccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggcaagaccctggagtcttggcggcggttcaccagccgctgctgctgcagc
tctcggcggggccacaagagcggtggcgctatggccgcaggagactatgcggaggccagc
gccgcgctcaccggcaggaccgggccgcctggccccaccgccgcataccacaagcaagtg
tccctgtcgcacgtatag

KEGG   Mus caroli (Ryukyu mouse): 110295197
Entry
110295197         CDS       T05910                                 

Gene name
Fzd10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110295197 (Fzd10)
   04390 Hippo signaling pathway
    110295197 (Fzd10)
   04150 mTOR signaling pathway
    110295197 (Fzd10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110295197 (Fzd10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110295197 (Fzd10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295197 (Fzd10)
   05205 Proteoglycans in cancer
    110295197 (Fzd10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110295197 (Fzd10)
   05226 Gastric cancer
    110295197 (Fzd10)
   05217 Basal cell carcinoma
    110295197 (Fzd10)
   05224 Breast cancer
    110295197 (Fzd10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295197 (Fzd10)
   05022 Pathways of neurodegeneration - multiple diseases
    110295197 (Fzd10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295197 (Fzd10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110295197 (Fzd10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110295197 (Fzd10)
   04090 CD molecules [BR:mcal04090]
    110295197 (Fzd10)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110295197 (Fzd10)
CD molecules [BR:mcal04090]
 Proteins
  110295197 (Fzd10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110295197
NCBI-ProteinID: XP_021019333
Ensembl: MGP_CAROLIEiJ_G0027774
UniProt: A0A6P5PYZ0
LinkDB
Position
5
AA seq 582 aa
MQLPGPRLWLVLQVMIGSCAAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHE
NQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSP
IMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQE
HPLKDGVPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCF
FSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYV
IQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAW
AIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVA
LFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQH
KCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGL
KRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcaactcccgggcccgcgcctgtggctggtgctgcaggtgatgataggctcgtgcgcg
gccatcagctccatggacttagagcgccctggagacggcaagtgccagccggtggagatt
cccatgtgcaaggacatcggctacaacaccacccgcatgcccaacctgatgggtcacgag
aaccagcgcgaggcggccatccaactgcacgagttcgcgccgctcgtggagtacggctgc
cacagccacctccgcttcttcctgtgttcgctgtacgcgcccatgtgcaccgagcaggtc
tccacacccatccctgcttgccgagtcatgtgcgagcaggcccggctcaagtgctcgccg
atcatggagcagttcaaattcaggtggccggactccctggattgcagcaagctccccaac
aagaacgatcccaactacctgtgcatggaggcacccaacaacggctcggatgagcccagc
cggggctctggcatgtttcctccgctcttcaggccccagaggccccacagcgcgcaggag
cacccactaaaggacggggttccggggcgcgcaggttgtgacaacccaggcaagttccac
cacgtggagaagagcgaatcttgcgcaccgctttgcactccgggggtggatgtgtattgg
agccgcgacgacaagcgcttcgctgtggtctggctggccatctggtccgtgctgtgcttc
ttctccagcgccttcaccgtgctcaccttcctcatcgacccatcgcgcttcaggtacccc
gaacgtcctatcatcttcctctccatgtgctactgcgtttattcggtgggctatatcatc
cgcctcttcgcgggcgcggagagcatcgcttgtgaccgggacagcgggcagctgtatgtt
atccaggaaggactggaaagcacgggctgtaccttagtcttcttggtactttactacttc
ggcatggccagctctttatggtgggtggtcctcaccctcacttggttcctggctgctgga
aagaagtggggccatgaggccattgaagccaacagcagctactttcacctggcagcttgg
gccatcccggctgtgaagactatcttgatcttggtgatgcgcagggtggcaggggatgag
ctcactggtgtgtgttatgtgggcagcatggatgtcaatgctctgaccggcttcgtgctg
gtcccgctggcttgctacctagtcatcggcacttccttcatcctgtccggctttgtggct
ttattccacatccggagggtgatgaaaacgggtggggagaacacggacaagctggagaag
ctcatggtacgcataggggtcttctccctcctctacactgtgccggccacctgtgtgatt
gcttgctatttttatgaacgcctcaacatggactactggaagatgctggccacccagcac
aagtgtaagatgaacaatcagaccaagacacccgactgcctgatgaccacctccatccct
gccgtggaggtcttcatggtcaaagtgtccatgctgctggtggtgggcatcaccagtggg
gtgtgggtctggacttccaagaccctgcagtcctggcaacacgtatgcagccgggggcta
aagagaaaaagccggaggaaaccagccagtgtggtcaccagtgcagggatctacaaaaaa
gcccagcacccccaaaaacctcaccttgggaagtatgagctgccggcccagccttcagcc
tgcgtgtga

KEGG   Mus caroli (Ryukyu mouse): 110295350
Entry
110295350         CDS       T05910                                 

Gene name
Fzd9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110295350 (Fzd9)
   04390 Hippo signaling pathway
    110295350 (Fzd9)
   04150 mTOR signaling pathway
    110295350 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110295350 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110295350 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295350 (Fzd9)
   05205 Proteoglycans in cancer
    110295350 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110295350 (Fzd9)
   05226 Gastric cancer
    110295350 (Fzd9)
   05217 Basal cell carcinoma
    110295350 (Fzd9)
   05224 Breast cancer
    110295350 (Fzd9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295350 (Fzd9)
   05022 Pathways of neurodegeneration - multiple diseases
    110295350 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295350 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110295350 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110295350 (Fzd9)
   04090 CD molecules [BR:mcal04090]
    110295350 (Fzd9)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110295350 (Fzd9)
CD molecules [BR:mcal04090]
 Proteins
  110295350 (Fzd9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 110295350
NCBI-ProteinID: XP_021019530
Ensembl: MGP_CAROLIEiJ_G0027832
UniProt: A0A6P5PZF5
LinkDB
Position
5
AA seq 592 aa
MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
LRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRP
ARPSGDSAPGPGSXGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWS
ALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAG
ALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFH
MAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLT
GFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLR
ATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS
LCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggccgtgccaccgctgctccgcggggcgctgctgctgtggcagctgctggcgacgggc
ggcgcggcgctggagatcggccgcttcgatccggagcgcggccgtggccccgcaccgtgc
caagcgatggagatccccatgtgccggggcattggctacaacctgacccgcatgcccaac
ctactgggccacacgtcgcagggcgaggcggcggcgcagctggccgagttctcgcccctc
gtgcagtacggctgccacagccacctgcgcttcttcctctgctcgctctacgccccaatg
tgcaccgaccaggtctccactcccatcccggcctgccggcccatgtgcgagcaggctcgc
ctgcgctgcgcccccatcatggagcaattcaattttggctggcccgactcactcgactgt
gcccggctccccacgcgcaacgacccgcacgcactctgtatggaggcacccgagaacgct
acagcaggccccacagaaccccacaagggcctgggcatgctccctgtggcacctcgaccc
gcgaggccatcgggagattcagccccaggtcccggcagcgntggcacctgcgacaacccc
gagaagttccagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccaggagtc
gaggtgttctggtctcggcgcgataaggacttcgcgctggtttggatggctgtgtggtcc
gcgttgtgtttcttctccacggctttcaccgtgttcaccttcctgctggagcctcaccgg
ttccagtacccagagcgcccgattatcttcctttccatgtgctacaatgtctactccttg
gccttcctgatcagagcggtggcaggtgcacagagtgtggcatgcgaccaggaggcaggg
gctctgtatgtgatccaggagggtctggaaaacacaggctgcaccctggtcttcctgttg
ctctattatttcgggatggccagctcactttggtgggtggttttgactctaacctggttc
ctggctgcaggcaaaaaatggggccacgaggccatcgaggctcacggcagctacttccac
atggcagcgtggggcctgccagcactcaaaactatcgtggtcctgactctgcgcaaggtg
gctggggatgaactgactgggctctgctatgtagccagcatggacccggcagccctcact
ggctttgtgttggtacccctatcttgctacctggtactgggcaccagtttcctcctgacc
ggttttgtggctctcttccatatccgcaaaatcatgaagacaggaggcaccaatacggag
aagctggagaagctgatggtcaaaatcggagtcttttccatcctttacacagtgccggcc
acctgcgtcattgtctgctacgtttatgaacgcctcaacatggacttctggcggcttcgg
gccacagagcaaccatgtactgctgccaccgtgcctggaggccggagagactgctcgctg
ccagggggctcggtgcccactgtggctgtcttcatgctcaaaatcttcatgtccttggtg
gtgggcatcaccagtggagtctgggtatggagttccaagacttttcagacttggcagagc
ctgtgctaccgaaaaatggcagctggccgagcccgggccaaggcctgccgaaccccaggg
ggctatggccggggtacccactgccactacaaagcccccacggtggtcttgcacatgact
aagacagacccctctctggagaaccccacacacctctag

KEGG   Mus caroli (Ryukyu mouse): 110298417
Entry
110298417         CDS       T05910                                 

Gene name
Fzd4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110298417 (Fzd4)
   04390 Hippo signaling pathway
    110298417 (Fzd4)
   04150 mTOR signaling pathway
    110298417 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110298417 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110298417 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298417 (Fzd4)
   05205 Proteoglycans in cancer
    110298417 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110298417 (Fzd4)
   05226 Gastric cancer
    110298417 (Fzd4)
   05217 Basal cell carcinoma
    110298417 (Fzd4)
   05224 Breast cancer
    110298417 (Fzd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110298417 (Fzd4)
   05022 Pathways of neurodegeneration - multiple diseases
    110298417 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110298417 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110298417 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110298417 (Fzd4)
   04090 CD molecules [BR:mcal04090]
    110298417 (Fzd4)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110298417 (Fzd4)
CD molecules [BR:mcal04090]
 Proteins
  110298417 (Fzd4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 110298417
NCBI-ProteinID: XP_021023313
Ensembl: MGP_CAROLIEiJ_G0029973
UniProt: A0A6P5Q3N3
LinkDB
Position
7
AA seq 537 aa
MAWRGTGPSIRGAPGGVGLRLGLLLQLLLLLRPTLGFGDEEERRCDPIRIAMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcacagggccgagcatccggggggcgcctggaggcgtcgggctcagg
ctggggctgctgctgcagttgctcctgctcctgcggccgacactggggttcggggacgag
gaggagcggcgctgcgaccccatccgcatcgccatgtgccagaacctcggctacaacgta
accaagatgcccaacttagtgggacacgagctgcagacagacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgtggtggcatg
tgtctttcagtcaagagacgctgtgaaccagtcctgaaagaatttgggtttgcctggccg
gacagcctgaactgcagcaagttcccaccccagaatgaccacaaccacatgtgcatggaa
ggaccaggtgatgaagaggtacccttgccccacaaaactcccatccagcctggggaagag
tgccactcagtgggaagcaattctgatcagtacatctgggtgaagaggagcctgaactgt
gttctcaagtgtggctacgatgctggcttgtacagccgctcagctaaggagttcacggat
atttggatggctgtgtgggccagcctctgcttcatctctaccaccttcactgtgctgacc
ttcctgatcgattcatccaggttttcttaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgttcggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcggcagaacccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagccggactcaagtggggtcatgaagccatt
gaaatgcacagttcttatttccacatcgcagcctgggccattcctgcagtgaaaaccatt
gtcatcttgattatgagactagtggatgccgatgaactgactggcttgtgctatgttggg
aaccaaaacctagatgccctcactggctttgtggtggctcctctctttacgtatttggtg
attggaacgctgttcattgcagctggtttggtggccttattcaaaattcggtccaatctt
caaaaagacgggacaaagacagacaagttggaaaggctaatggtcaagatcggggtcttc
tcagtactgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctca
aactgggcactctttcgatattctgcagatgactcaaacatggcagtcgaaatgttgaaa
atttttatgtctttgctcgtgggcatcacctcaggcatgtggatttggtctgccaaaact
cttcacacgtggcaaaagtgttctaaccgattggtgaattctgggaaggtaaagagagag
aagagggggaatggttgggtgaagccagggaaaggcaatgagactgtggtataa

KEGG   Mus caroli (Ryukyu mouse): 110301431
Entry
110301431         CDS       T05910                                 

Gene name
Fzd7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110301431 (Fzd7)
   04390 Hippo signaling pathway
    110301431 (Fzd7)
   04150 mTOR signaling pathway
    110301431 (Fzd7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110301431 (Fzd7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110301431 (Fzd7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301431 (Fzd7)
   05205 Proteoglycans in cancer
    110301431 (Fzd7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110301431 (Fzd7)
   05226 Gastric cancer
    110301431 (Fzd7)
   05217 Basal cell carcinoma
    110301431 (Fzd7)
   05224 Breast cancer
    110301431 (Fzd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110301431 (Fzd7)
   05022 Pathways of neurodegeneration - multiple diseases
    110301431 (Fzd7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110301431 (Fzd7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110301431 (Fzd7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110301431 (Fzd7)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110301431 (Fzd7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 110301431
NCBI-ProteinID: XP_021027564
Ensembl: MGP_CAROLIEiJ_G0014178
UniProt: A0A6P5QBV2
LinkDB
Position
1
AA seq 572 aa
MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcggggccccggcacggcggcgtcgcactcgcccctgggcctgtgcgccctggtgctt
gctcttctgggcgcgctgcccacggacacccgggctcagccataccacggcgagaaaggc
atctcggtaccggaccacggcttctgccagcccatctccatcccgttgtgcacggatatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccaattctaccctctggtaaaggtgcagtgttctcccgagctacgcttc
ttcttatgctctatgtacgcacccgtgtgcactgtgctcgaccaagccattcctccgtgc
cgttccttgtgcgagcgcgcccgacagggctgcgaggcgctcatgaacaagttcggcttc
cagtggccagagcggttgcgctgcgagaacttcccagtgcacggcgccggcgagatctgc
gtgggacagaacacgtccgacggctccgggggcgcgggcggcagtcccaccgcttaccct
actgctccctacctgccagacccacctttcactgcgatgtccccctcagatggcagaggc
cgcttgtctttccccttctcgtgtccgcgccagctcaaggtgcccccctacctgggctac
cgcttcctaggtgagcgtgactgcggtgccccgtgtgagccgggccgtgctaacggcctc
atgtactttaaagaagaggagagacggttcgcccgcctctgggtgggtgtgtggtcagtg
ctgtgctgcgcctcgacgctcttcacggtgctcacctacctagtggacatgcgtcgcttc
agctatccagagcgacctatcatcttcctgtcgggttgctacttcatggtggcagtggcg
cacgtggcgggcttcctgctagaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggtatggccagctccatctggtgggtcattctgtccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggctaactcgcagtactttcat
ctggccgcgtgggctgtgccagcggtcaagacaatcaccatcttggccatgggccaggtg
gatggtgacctactcagtggagtgtgctacgtgggcctgtctagtgtggatgcattgcgg
ggcttcgtgctggcgcccttgttcgtctacctcttcatcgggacgtccttcctgttggcc
ggctttgtgtctctctttcgcatccgcaccatcatgaagcacgacggcaccaagacggag
aagctggagaagctgatggtgcgcatcggcgtcttcagcgtgctctacacggtgccggcc
accatcgtcctggcctgctacttttatgagcaggccttccgagagcactgggaacgcacc
tggctcctgcagacctgcaagagctacgctgtgccctgccctccgggccacttctctccc
atgagccccgactttacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actacgggcttctggatctggtcgggcaagaccctgcagtcatggcgtcgcttctaccac
agactcagccacagcagcaagggggaaactgcggtatga

KEGG   Mus caroli (Ryukyu mouse): 110305336
Entry
110305336         CDS       T05910                                 

Gene name
Fzd2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110305336 (Fzd2)
   04390 Hippo signaling pathway
    110305336 (Fzd2)
   04150 mTOR signaling pathway
    110305336 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110305336 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110305336 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305336 (Fzd2)
   05205 Proteoglycans in cancer
    110305336 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110305336 (Fzd2)
   05226 Gastric cancer
    110305336 (Fzd2)
   05217 Basal cell carcinoma
    110305336 (Fzd2)
   05224 Breast cancer
    110305336 (Fzd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110305336 (Fzd2)
   05022 Pathways of neurodegeneration - multiple diseases
    110305336 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110305336 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305336 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110305336 (Fzd2)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110305336 (Fzd2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110305336
NCBI-ProteinID: XP_021032924
Ensembl: MGP_CAROLIEiJ_G0017257
LinkDB
Position
11
AA seq 570 aa
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPSGLQPG
AGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcctgctgctgccactgctg
ctgctgccggccgccgggccggcccagttccacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttcttggccacacgaaccaggaagacgccggcctggaggtgcatcag
ttctacccgctggtgaaggtgcagtgctcgcccgagctgcgcttcttcctgtgctccatg
tacgctccggtgtgcacagtgctggagcaggccatcccgccgtgccgctccatctgcgag
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggagcagatctgcgtgggccagaaccac
tcggaggacggagctcctgcgctactcaccaccgcgccaccttctgggctgcagcccggc
gcgggtggcaccccgggcggccctggcggtggtggcgcgccaccgcgctacgccactctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctgggtgagcgcgattgtgccgcgccctgcgagcctgcacggcccgacggctctatgttc
ttctcgcaagaggagactcgttttgcccgtctctggatcctcacatggtcggtgctgtgc
tgcgcttccaccttcttcacggtcaccacctatttagtggacatgcagcgattccgctac
ccagagcggcccatcatctttctgtccggctgctacaccatggtatcagtggcctacatt
gctggcttcgtgctccaggagcgcgtggtatgcaacgagcgcttctcagaggacggttat
cgcacggtggtgcagggtactaagaaagaaggctgcactatactcttcatgatgctctac
ttcttcagcatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccggaatgaagtggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcctgggctgtgccggccgtcaaaaccatcaccatcttggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaatagcctggaccctctgcggggcttc
gtgctggcgccgctcttcgtatacctgttcatcggtacatccttcctgctggccggcttc
gtgtcactcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctg
gagaggctcatggtgcgcatcggcgtcttctcggtgctctacaccgtaccggccaccatc
gtcatcgcctgctacttctatgagcaggccttccgcgagcactgggagcgctcctgggta
agccagcactgcaagagcctagccattccctgcccggcccactacacgccccgcatgtcg
cccgacttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacactgcactcgtggaggaagttctacacgcgtctc
accaacagccggcatggagagaccactgtgtga

KEGG   Mus caroli (Ryukyu mouse): 110309352
Entry
110309352         CDS       T05910                                 

Gene name
Fzd3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110309352 (Fzd3)
   04390 Hippo signaling pathway
    110309352 (Fzd3)
   04150 mTOR signaling pathway
    110309352 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110309352 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110309352 (Fzd3)
  09158 Development and regeneration
   04360 Axon guidance
    110309352 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309352 (Fzd3)
   05206 MicroRNAs in cancer
    110309352 (Fzd3)
   05205 Proteoglycans in cancer
    110309352 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110309352 (Fzd3)
   05226 Gastric cancer
    110309352 (Fzd3)
   05217 Basal cell carcinoma
    110309352 (Fzd3)
   05224 Breast cancer
    110309352 (Fzd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110309352 (Fzd3)
   05022 Pathways of neurodegeneration - multiple diseases
    110309352 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110309352 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110309352 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110309352 (Fzd3)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110309352 (Fzd3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110309352
NCBI-ProteinID: XP_021037625
Ensembl: MGP_CAROLIEiJ_G0019421
UniProt: A0A6P5R2Q3
LinkDB
Position
14
AA seq 666 aa
MAVSWIVFYLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgagctggattgtcttttatctttggctcttgactgtgtttctggggcagata
ggtgggcacagtttgttttcttgtgaacctataaccttgaggatgtgccaagatttgcct
tacaatactaccttcatgcctaatcttctgaaccattatgaccaacagactgcagcttta
gcaatggagcccttccaccctatggtgaacctggattgttctcgggattttcggccattt
ctttgtgcactctatgcccctatttgtatggaatatggacgtgtcacacttccctgccgt
aggctgtgtcagcgtgcctatagcgagtgttcaaaactcatggagatgtttggtgtcccg
tggcctgaagatatggagtgcagtaggtttccggattgtgatgagccatatccccgactt
gtggatttgaatttagttggagatccaactgaaggagccccagttgcagtgcagagggac
tatggtttttggtgtccccgagagttgaaaattgatcctgatcttggctattcctttctg
cacgtgcgagattgttcaccaccatgtcccaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcataggcctgatttcaatcatttgcctctctgccacgttgtttact
tttttaacctttctaattgacgtcacaagattccgttaccctgaaagacctatcatattt
tatgcagtctgctacatgatggtgtcattaattttcttcattgggtttttgctggaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttctacagtgacacaagga
tctcacaataaggcctgtaccatgctctttatggtactatattttttcactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggc
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcctggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgtcggcctctacgacgttgatgcgttaagatatttcgttctcgctcccctctgc
ctgtatgtggtagttggggtctctctccttttagccggcattatatccctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgattcgg
attggtgttttcagcattctctaccttgtgccactcttggttgtaattggatgttacttt
tatgagcaagcttaccgcggcatctgggagacaacatggatccaggaacgctgcagagag
tatcacattccatgtccgtaccaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaagtatctcatggctctcatagttgggattccctctattttttgggttggaagc
aaaaagacatgctttgaatgggccagttttttccatgggcgtaggaaaaaagagatagtg
aatgagagccggcaggtgctccaggaacctgactttgctcagtcactcctgagggaccca
aatactccaattataagaaagtcaagaggaacttccactcaagggacatccacacatgct
tcttcaactcagctggccatggtggatgaccaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgggatggcaggtacactccctgc
agttaccgaggaatggaggagagactacctcacggcagcatgtcacggctgacggatcat
tccaggcacagtagttctcatcggctcaacgagcagtcccgacacagcagcatccgagac
ctcagtaacaaccccatgactcacattacacatggcaccagcatgaaccgtgttattgag
gaggatggaaccagtgcttag

KEGG   Mus caroli (Ryukyu mouse): 110310580
Entry
110310580         CDS       T05910                                 

Gene name
Fzd6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310580 (Fzd6)
   04390 Hippo signaling pathway
    110310580 (Fzd6)
   04150 mTOR signaling pathway
    110310580 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310580 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110310580 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310580 (Fzd6)
   05205 Proteoglycans in cancer
    110310580 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110310580 (Fzd6)
   05226 Gastric cancer
    110310580 (Fzd6)
   05217 Basal cell carcinoma
    110310580 (Fzd6)
   05224 Breast cancer
    110310580 (Fzd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110310580 (Fzd6)
   05022 Pathways of neurodegeneration - multiple diseases
    110310580 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310580 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310580 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110310580 (Fzd6)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110310580 (Fzd6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 110310580
NCBI-ProteinID: XP_021039301
Ensembl: MGP_CAROLIEiJ_G0019754
UniProt: A0A6P7Q6H6
LinkDB
Position
15
AA seq 709 aa
MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQGIAAVEMQR
FLHLANLECSPNIEMFLCQAFVPTCTEQIHVVPPCRKLCEKIVSDCKKIMDTFGIRWPEE
LECNRLPHCDGTVPVTSHPHTELFGPQKKSDQVPRDIGFWCPKHLRTSGDQGYRFLGIEQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHGKPGAHKLKVISKSMGTSTGATTNHGTSAIAIADHDYLGQETSTEVQTSPEASVKEG
RADRANTPSVKDRDRGEPAGPSSKLSGDRNGRESRADGQTERSNGSEGAPSEGRVSPKSS
APETGLTDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGAGSHSDA
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggaaaggtccccgtttctgttggcgtgcattcttctgcccctcgttagaggacacagc
ctttttacctgtgagccaatcaccgttcccagatgtatgaaaatgacttacaacatgacg
ttcttccctaacctgatgggtcattatgaccaggggatcgctgctgtggaaatgcagcgc
tttctgcatcttgcaaatctagaatgttcaccaaacattgaaatgttcctttgccaagct
tttgtaccaacctgcacagagcaaattcatgtagttccaccctgtcggaaattgtgtgag
aaaatagtttctgattgcaaaaaaataatggacacttttggcatccgatggcctgaagaa
cttgaatgtaacagattgccacactgtgatggcactgttcctgtaacttctcatccacac
acagagctttttggtccacagaagaaatcagatcaagtcccaagagacattggattttgg
tgtccaaagcaccttaggacttccggggaccaaggctataggtttctgggaattgaacag
tgtgcccctccgtgccccaatatgtattttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactctgttcacgttccttacattt
ttaattgacgttagaagattcagatacccagagagaccaattatctattactctgtctgc
tacagcattgtctctctcatgtacttcgtggggtttttgctgggcaatagcacggcttgt
aataaggcagacgagaagctggagctcggggacaccgttgtcctggggtcaaagaataag
gcttgcagtgtggtatttatgtttctgtattttttcacaatggctggcaccgtgtggtgg
gtgattctcaccattacgtggttcttagctgccgggagaaaatggagttgcgaagctatt
gaacaaaaagcggtgtggttccatgccgttgcctggggggcgcccgggttcctgaccgtc
atgctgctcgctatgaacaaggttgaaggagacaacattagtggcgtttgtttcgttggc
ctgtatgacctggacgcctctcgctacttcgtccttttgcctctgtgcctctgcgtattt
gttgggctgtctctcctcttagccggcatcatctccttaaatcatgtccgacaagtcata
cagcatgatggccggaaccaagagaagctaaagaagttcatgattcgcatcggagtcttc
agtggcctgtatctcgtgcccttggtgacacttcttggttgctatgtctatgagctagtg
aacaggatcacctgggagatgacgtggttctctgatcattgtcaccagtaccgcatcccg
tgcccttaccaggcaaatccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctttaagcgaaaccgcaagcgagaccccatcagtgagagccga
cgagtgctgcaagaatcctgtgagttcttcctgaagcacaactctaaagtgaagcacaag
aagaagcatggcaaaccaggggctcataagctgaaggtcatttccaagtccatgggaact
agcacaggagcgaccacaaatcatggcacctctgccatagcaatcgctgaccatgattac
ttagggcaagaaacttcaacagaagtccagacctccccagaagcatccgtcaaagaggga
agagcagaccgagcaaacactcccagcgtcaaagatcgggaccgtggggaacccgcaggg
cccagctccaagctctctggggaccgcaatggcagggaaagccgagcggacggccagacg
gagagaagcaatggatcagaaggggctccaagtgaaggaagggtaagtccaaagagcagt
gctcctgagactggcctgacagactgcagcacttcacaggccgccagttctccagaacca
accagcctcaaaggctccacatctctgcctgttcactcagcttccagagctaggaaagag
cagggtgctggcagccattccgacgcttga

DBGET integrated database retrieval system