KEGG   Mus caroli (Ryukyu mouse): 110284749
Entry
110284749         CDS       T05910                                 

Gene name
Zeb1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110284749 (Zeb1)
   05206 MicroRNAs in cancer
    110284749 (Zeb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110284749 (Zeb1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    110284749 (Zeb1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-Di19 zf-met Homeodomain zf-C2H2_6 zf-C2HE
Other DBs
NCBI-GeneID: 110284749
NCBI-ProteinID: XP_021006282
Ensembl: MGP_CAROLIEiJ_G0021973
UniProt: A0A6P5NYU7
LinkDB
Position
18
AA seq 1114 aa
MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEESITDAADCEGGMPDD
ELPADQTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYP
EAPEEDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF
SCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLR
IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRSGLKTSQCSSPSLSTSP
GSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSSGGQ
LQAASSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLETNQASLASKE
QEAVSASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPAPT
NSCKSEKLPEDLTVKSEMDKSFEGARDDSTCLLCEDCPGDLNALPELKHYDPECPAQPPP
PAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKAYYALNAQPSTEELSKIADSVNLPL
DVVKKWFEKMQAGQIPGQSPEPPSPGTGSVNIPTKTDEQPQPAEGTETQADSTRAQSPLK
IRSSPVLPEGSAINGSRSCTSSPSPLNLCSARNPQGYACVAEGAQEEPQVEPLDLSLPKQ
QGELLERSTVSSVYQNSVYSIQEEPLNLSCAKKEPQKDSCVTDSEPVVNVVPPSANPINI
AIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSATVSPAVQEPPVKVIQ
PNGNQDERQDTSSEGVSTVEDQNDSDSTPPKKKTRKTENGMYACDLCDKIFQKSSSLLRH
KYEHTGKRPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHR
YSYCKRGAEDRDAMEQEDAGPEVLPEVLTTEHVGARASPSQADSDERESLTREEDEDSEK
EEEEEDKEMEELQEGKECENPQGEEEEEEEEEEEEEEEEVEADEAEHEAAAKTDGTVEDG
AAQQAGSLEQKASESEMESESESEQLSEEKTNEA
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaagcaaattcagattccgatgatgaagacaaactccat
attgtggaagaagaaagtattacagatgcagctgactgtgaaggtggcatgccagatgat
gaattgccagcagaccagacagtgttaccaggaggcagtgacagggggggcggtgccaag
aactgctggcaagacaacgtaaaagacaatgagtgtgactcagatgcagaaaatgagcaa
aaccatgatccgaatgtggaagagtttctgcagcaacaagacaccgccgtcatttatcca
gaggcacctgaggaagaccagcggcagggcacaccagaagccagcagtcatgacgaaaac
ggaacaccagacgcattttcccagttgctcacctgcccgtattgtgatagaggctacaag
cgctttacctctttgaaagaacacattaagtaccgccatgagaagaacgaggacaacttc
agctgctccctgtgcagttacacctttgcatacagaacccagcttgaacgtcatatgaca
tcacataagtcaggaagagagcaaagacatgtgacccagtctgggggaaaccgtaaattc
aaatgcactgaatgtgggaaagccttcaagtacaaacaccacctgaaagagcacttacgg
attcacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttctcattct
ggctcctatagctcacatataagcagtaagaagtgtattagcttgatgcctgtgaatggt
aggcctagatcaggactcaagacatctcagtgttcctcgccatctctttcgacatcacca
ggcagtcccacacgcccacagatacgacagaagatagagaataaaccccttcaagaaccg
ctttctgtaaaccaaatcaaaactgaacctgtggattatgagttcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggtttttagcagtggtggccaa
ttgcaggcagccagttctcctcagggtgtggtgcaagccgttgttctgccgacagttggt
ctggtatctcccataagtatcaacttgagtgacattcagaatgtacttaaagtggctgta
gatggtaacgtaatacgacaagtcttggagactaatcaagccagtcttgcatccaaagag
caagaagcagtgagtgcttcatccatccagcagggtggccattctgtcatttctgccatc
agtcttcctttagttgatcaggatggaacaaccaaaatcatcatcaactacagtcttgag
cagcccagtcagcttcaggttgttccccagaatttaaagaaagaaaacccagcccctaca
aatagctgcaaaagtgagaagttaccagaagaccttactgtcaaatcagaaatggacaaa
agctttgaaggggccagggacgatagcacttgccttctgtgtgaggactgcccaggggac
ctcaatgcacttccagaactaaagcactatgatccagagtgccctgctcagcctccaccc
cctgccccagccacagagaagccagagtcctctgcttcctcagctggaaatggagatttg
tctcccagtcagccacctttaaagaaccttctgtcactcttaaaagcctactatgctctg
aacgcgcagccaagcacagaagagctctcaaagattgccgattctgtgaacctaccactg
gatgtagttaaaaagtggtttgagaaaatgcaagctggacagattccaggacagtctcct
gaaccaccttctcctggaacagggtctgtaaacatacctacaaaaaccgatgagcagcct
caacctgcagagggaactgagacccaggcagacagcacacgtgcacagagtcctctcaag
atcaggagctctccggttttaccggaaggatcagccattaacggttccagaagttgcaca
tcatccccgtcccctctaaacctttgctcagccaggaacccgcagggttacgcttgtgtg
gcagagggtgcccaggaggagccccaagtagaacctcttgatctctcactaccaaagcaa
cagggagagttactggaaaggtcgacagtcagtagcgtttaccagaacagtgtttattct
atccaggaagaacccttgaacttgtcttgtgcaaaaaaggaaccacaaaaggacagctgt
gttacagactcagaaccagttgtaaatgtagtcccaccaagtgccaaccccataaacatt
gctattcctacagtcactgcccagttacccacaatcgtggccattgctgaccagaacagt
gttccatgtttaagggcactggccgccaacaagcagactattctgattccccaagtggca
tatacatattcagctacagtgagccctgccgtgcaggagccaccagtgaaggtgatccag
ccaaatggaaaccaggatgaaagacaagacactagctcagaaggagtctccactgtggag
gaccagaatgactctgactccacgccacccaaaaagaaaactcggaagacagagaatgga
atgtatgcatgtgacctgtgtgacaagatatttcagaagagcagctcactgttgagacac
aaatatgagcacacaggtaagaggcctcacgagtgtggaatctgtagaaaggcatttaaa
cacaagcatcatttgattgagcatatgcggctgcactctggggaaaagccctatcaatgt
gacaagtgtggcaagcgcttctcacactccggctcctactctcaacacatgaatcaccgc
tactcctactgcaagagaggagctgaagacagagatgccatggagcaggaagacgctggg
cccgaagtcctgccggaagtcctgacgactgagcatgttggtgcccgggcatctccctca
caggctgactcggacgagagagaaagtttgacaagggaagaggatgaagacagtgaaaag
gaggaggaagaggaagataaagagatggaagaattacaggaaggaaaggaatgtgagaac
ccacagggggaggaggaagaggaggaggaagaagaagaagaggaagaagaggaggaagtg
gaggcggatgaagcggagcatgaggcagcagccaagactgatggtacagtggaggacgga
gctgcacagcaggcaggcagcttagagcagaaggccagcgagagcgagatggagagcgag
agcgagagtgagcaactgtcggaagagaagacaaatgaagcttag

DBGET integrated database retrieval system