KEGG   Mus caroli (Ryukyu mouse): 110284757
Entry
110284757         CDS       T05910                                 

Gene name
Dcc
Definition
(RefSeq) netrin receptor DCC
  KO
K06765  deleted in colorectal carcinoma
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04360  Axon guidance
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110284757 (Dcc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284757 (Dcc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284757 (Dcc)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 CD34_antigen EphA2_TM V-set_CD47 FAM176 Ly49 Cadherin_C_2
Other DBs
NCBI-GeneID: 110284757
NCBI-ProteinID: XP_021006289
Ensembl: MGP_CAROLIEiJ_G0022390
UniProt: A0A6P5P226
LinkDB
Position
18
AA seq 1447 aa
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKPFTSLHFVSEPSDAVTMRGGNVLLN
CSAESDRGVPVIKWKKDGLLLALGMDDRKQQLPNGSLLIQNILHSRHHKPDEGLYQCEAS
LADSGSIISRTAKVTVAGPLRFLSQTESITAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
NPIPGDSRVVVLPSGALQISRLQPGDSGVYRCSARNPASIRTGNEAEVRILSDPGLHRQL
YFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKP
AIPSSSILPSAPRDVLPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTS
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLHAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNISLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLFDDFPTSGPDV
STPMLPPVGVQAVALTHEAVRVSWADNSVPKNQKTSDVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLSLDTMYYF
RIQARNVKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVITVVTVGVLTVLVVVIVAVICTRRSSAQQRKKRATHSVSK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPVGTDPAGRDSPIQSCQDLTPVSHSQSETQMGS
KSASHSGQDTEDAGSSMSTLERSLAARRATRAKLMIPMEAQSSNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTQSVSEGPTTQQQPMLPPAQPEH
PSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccttgctcagcgcgcatcttcaagtcacgggtttccaaattaaacctttcacgtcactt
cattttgtgtcggaaccttcggatgctgtcaccatgcggggaggaaatgtcctgctcaac
tgttctgcagagtctgaccgaggagttccagtcatcaagtggaagaaagacggccttctc
ctagccttgggcatggatgacagaaagcagcaacttcctaatggatctctgttgatacaa
aacatacttcattccagacaccataaaccagatgaaggactttaccaatgtgaggcatcc
ttagcagattctggctcaattattagtcggacagcaaaagttacggtagcagggccattg
aggttcctttcccagacggaatctatcacagccttcatgggagatacagtgttacttaag
tgtgaagtcattggggaacccatgccaacaatacactggcagaaaaatcaacaagacctc
aacccaattccaggagactcgcgtgtggtcgtcttgccctccggagcattgcagatcagc
cgacttcagccaggagacagtggagtctacagatgctcggctcggaatccagccagcata
agaacaggaaatgaagcagaagttagaattttatcagacccaggcctgcataggcagctg
tattttctgcagagaccatccaacgtaatagccattgaagggaaagatgctgtcctggag
tgctgtgtttctggctatcctccgccaagtttcacctggttacgaggcgaggaggtcatc
caactcaggtctaaaaagtattcgttgttgggtggaagcaatttgctcatctctaatgtg
acagatgatgacagtggaacctatacttgcgttgtcacctataagaatgagaatattagt
gcctctgcagagctcacggtcttggttccgccctggtttttaaatcacccttccaacctc
tatgcctatgagagcatggatattgagtttgaatgtgcagtttctgggaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtgattccgagtgactattttcagatagtg
ggaggaagcaacttacggatccttggggtggtcaagtcagatgaaggcttctatcaatgt
gtggctgaaaatgaggctggcaatgcccaaagtagtgcccagctgattgtccccaagcct
gccatcccaagctccagcatcctcccttctgctcccagagatgtgctccctgtcttggtt
tctagtcgctttgtccgtttgagctggcgtccacccgcagaagcaaaagggaacattcaa
accttcacagtctttttctccagagagggtgacaacagggagcgagctttgaatacaagc
cagcctgggtcgcttcagcttactgtgggaaacttgaaaccagaagccatgtacaccttc
agagttgtcgcctacaatgagtggggaccaggggagagttctcagcccatcaaggtggcc
actcagcctgagttgcaagttccagggccagtagaaaacctgcatgctgtatctacctca
cctacctcaattcttattacatgggaaccccctgcctatgcaaatggcccagtccaaggt
tacagattgttctgcactgaggtttctacaggaaaagaacagaatatagaagttgatgga
ctatcttataaactggaaggcctgaaaaaattcacggaatatactcttcgattcctagct
tataatcgttatgggccaggagtatctactgatgatataacagttgttacactttcagac
gtgccaagtgctccacctcagaacatctcactggaagtggttaactcaaggagtatcaaa
gtaagctggctccctcctccatcgggaacacaaaatggatttattactggctataaaatt
cgacacagaaagactacccgcaggggcgagatggaaacactggaaccaaataacctctgg
tacctcttcacaggattggagaaaggcagtcagtacagtttccaagtgtcggccatgaca
gtcaatggtactggaccaccttccaactggtacacagcggagaccccagagaatgattta
gatgagtctcaagtccctgaccagccgagttctcttcacgtgaggccccagacaaactgt
atcatcatgagttggacacctcctctcaacccaaacattgtggtgagaggctatattatc
ggctatggtgttggcagtccttatgctgagactgtgcgcgtggacagtaagcagcggtac
tattccattgagagactagagtcgagttctcattatgtaatctccttaaaagctttcaac
aatgccggagaaggtgtccctctctacgaaagtgccaccactcgttccataacagatccc
actgaccccgttgattattatcctttgtttgatgatttccccacctcgggcccagatgtc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgaggctgtg
agggtcagctgggcagacaactctgtcccgaagaaccagaaaacatccgatgtgcgactg
tacaccgttcgctggaggaccagcttttctgccagtgccaagtacaagtcagaagacaca
acatctctcagttacacagcaactggcctcaagcccaataccatgtacgagttctccgtc
atggtgaccaagaacagaaggtcaagcacgtggagcatgactgcacacgccaccacctac
gaagctgccccaacttctgctcccaaggatctgacagtcattactcgagaggggaagcct
cgtgctgtcattgtgagttggcagcctcccttggaagccaatgggaaaatcactgcttac
atcttgttttatacattggacaagaatataccaatagatgattggattatggaaactatc
agcggtgaccggcttacccatcagatcatggatctcagccttgacacgatgtattacttt
cgaattcaagcacggaatgtgaaaggagtagggcccctctctgatcccatcctcttcagg
actttgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaacttgattgatagaagcactctcaacgaaccacccatt
ggacagatgcaccccccacatggcagtgtcactcctcagaagaacagcaacctgcttgtg
ataaccgtggtcaccgttggcgttctcactgtgttggtcgtggtgattgtagcagtgatt
tgcacccggcgctcttcagcgcagcagaggaagaaacgggccacacacagtgtgagcaag
aggaagggcagtcagaaggacctccggcctcccgatctttggatacatcatgaagaaatg
gaaatgaaaaatatcgagaagcctgtgggaactgaccctgcaggaagagactcccccatc
cagagctgccaagatctcacaccagtcagccatagccagtcagaaacccagatgggaagc
aaaagtgcctctcattcaggtcaggacactgaagacgcaggaagctccatgtccactctg
gagcggtccctggcagcacgcagggccaccagggccaagctcatgattcccatggaggcc
cagtccagtaatcctgctgttgtgagtgccatccctgtaccaacactagaaagtgcccag
tatccaggaatcctcccatctcccacatgtggatacccgcatccacagttcactctccgg
ccagtaccattcccaacactgtctgtggaccgaggttttggagcaggaagaactcagtct
gtgagtgaaggaccaaccacgcaacagcaacccatgctgcccccagctcagcccgaacat
ccgagcagtgaagaagcacccagtagaaccatccccacagcctgtgtgcggccaactcat
ccactccgcagctttgctaacccgttgctacctccacctatgagtgcaatagaaccaaaa
gtcccttacacaccgcttttgtctcagccaggacccacccttcccaagactcatgttaaa
acagcctcccttgggctagccggaaaggcaaggtcccctttgcttccagtgtctgtgcca
acagcccctgaagtgtctgaggagagtcacaagccaacagaggatccagccagtgtatat
gaacaggatgacttgagcgaacaaatggcaagtttggaagggctaatgaagcaactcaac
gccatcacagggtctgccttttga

DBGET integrated database retrieval system