KEGG   Mus caroli (Ryukyu mouse): 110284823
Entry
110284823         CDS       T05910                                 

Gene name
Pard6g
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110284823 (Pard6g)
   04390 Hippo signaling pathway
    110284823 (Pard6g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110284823 (Pard6g)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110284823 (Pard6g)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110284823 (Pard6g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284823 (Pard6g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110284823 (Pard6g)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110284823 (Pard6g)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110284823
NCBI-ProteinID: XP_021006402
Ensembl: MGP_CAROLIEiJ_G0022430
UniProt: A0A6P5NTM2
LinkDB
Position
18
AA seq 382 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYQLVVHTHHISNTEV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEADHYSFGAGTLSRKKKVLVT
LRDEGLRRRPHLNISMPHDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRSSRTSGSSVHSTDSTTSHHSLPGAHVLQNSEDVESDEEADIV
IEGALEPQHIPKTQAVPPGSLSRANGTSLAHRLHRGDMSLHSSGRESNGSIHRFLSSLKP
DPRHSLVLPQGGVEEHGPAITL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcataagtctcagaccctacgcttctacgactgcagcgctgtggaa
gtcaagagcaagtttggcgccgagttccgaaggttctccttggaccgccacaagcctggg
aagtttgaagatttctaccagctggtggtgcacacccaccacatctctaacaccgaggtg
accatcggctatgccgatgtgcacggggacctgctgcccatcaacaatgacgacaacttc
tgcaaggcggtctcaagtgcaaaccccttgcttcgagtcttcatccagaagcgagaagag
gcagaccattacagcttcggagcaggcactctgtcacggaagaaaaaggtgctggtgacc
ctgagggatgagggtctgcgtcggcgtccccacctcaacatcagcatgccgcatgacttc
cgcccagtgtcatccatcatcgatgtggacatcctcccagagacgcaccgccgagtgagg
ctctacagacacggctgtgagaagccactgggcttctacattcgagatggcaccagcgtg
cgggtgacgccccatgggctagaaaaggtaccaggtatcttcatttctcgaatggtgccc
gggggccttgcagagagcactgggctactggctgtgaatgatgaagtcctggaggtgaat
gggattgaggtagctggaaagacattggatcaagtcacagacatgatgatagccaacagc
cacaacctcattgtcactgtcaagccggccaaccaaaggaacaatgtggtccgcagcagc
cgcacgtccggcagctctgtgcattccacagacagcaccaccagtcaccacagcctgcca
ggtgcccatgtcctgcagaattctgaggatgtggagagtgacgaggaagccgacattgtc
attgaaggggctctagaacctcaacacattcccaagacgcaggctgtacctccaggcagc
ctctccagggccaatggcaccagccttgctcacaggctgcacagaggggacatgagcctg
catagctctgggagggagagcaacggcagcatccacagatttctcagctctctgaagcca
gatccccgacacagcctggtcctcccccaaggaggggtggaggaacatgggccagccatt
acactctag

KEGG   Mus caroli (Ryukyu mouse): 110287295
Entry
110287295         CDS       T05910                                 

Gene name
Pard6b
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110287295 (Pard6b)
   04390 Hippo signaling pathway
    110287295 (Pard6b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110287295 (Pard6b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110287295 (Pard6b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110287295 (Pard6b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110287295 (Pard6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110287295 (Pard6b)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110287295 (Pard6b)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110287295
NCBI-ProteinID: XP_021009610
Ensembl: MGP_CAROLIEiJ_G0024715
UniProt: A0A6P5P9Z9
LinkDB
Position
2
AA seq 371 aa
MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNMLSNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIED
SGEPQQIPKATPTQSLESLTHIELSFESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQK
LLEEDGTIITL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaaccgcggccaccggcacggggcgagcagcggctgcctgggcaccatggaggtgaag
agcaagtttggagctgagtttcgtcggttttcactggaaagatctaagcctggaaaattt
gaggagttttacggactgctgcaacatgttcacaagatccccaatgtcgacgtgttggtg
ggctacgcagatatccatggggacctgctgcccataaataacgatgacaactaccacaag
gcggtgtccaccgccaatccactgctcaggatttttatacagaagaaggaagaagctgac
tacagcgcctttggcaccgacaccctaatcaggaagaagaacatgctgagcaatgtactg
cgtcccgacaaccaccggaagaagcctcacatcgtcatcagcatgccgcaggacttccgg
cccgtgtcatccatcatcgacgtggacatcctcccggagacgcaccggagggtccgtctg
tacaagtacggcacagagaagccgctgggcttctacatccgggatggctccagcgtccgg
gtgacaccgcacggcttggagaaagtccccggcatcttcatatctcggctcgtccctggg
ggtctggcccagagcacaggcctgctagctgtcaacgatgaggtgttagaagtcaacggt
atagaagtgtccgggaagagcctggaccaggtgactgacatgatgatagccaacagccgc
aacctcatcatcaccgtgcgcccggccaaccagaggaacaacgtggtgcgcaacagtcgg
acttctggcagctccagccagtccactgacaacagcctcctgggcttcccacagcaggtg
gaggccagcttcgagcccgaggaccaagacagcgacgaggacgacatcatcattgaagac
agtggcgagccgcagcagatcccgaaggccacccccacccagagcctggagtccctgacg
catatcgagctcagctttgagtccggacagaacgggttctcccctcctcaggacacaagc
ctggtgcctgtgcccggcagcctggacacagagctggaaagccgggctccggaccagaaa
ctcttagaggaagatgggacaatcataacattgtga

KEGG   Mus caroli (Ryukyu mouse): 110299798
Entry
110299798         CDS       T05910                                 

Gene name
Pard6a
Definition
(RefSeq) partitioning defective 6 homolog alpha isoform X1
  KO
K06093  partitioning defective protein 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110299798 (Pard6a)
   04390 Hippo signaling pathway
    110299798 (Pard6a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110299798 (Pard6a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110299798 (Pard6a)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110299798 (Pard6a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110299798 (Pard6a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110299798 (Pard6a)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110299798 (Pard6a)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110299798
NCBI-ProteinID: XP_021025317
Ensembl: MGP_CAROLIEiJ_G0031491
UniProt: A0A6P5Q613
LinkDB
Position
8
AA seq 346 aa
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSDLVIENRHPPCSNGLSQ
GPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggccaggccgcagaggactccggcgcgcagtcccgatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgctttgcactaccccgcacttcggtgagaggctttcag
gagttctcgcgattgctgtgtgtggtacaccagatccctggcctggacgtcctgcttggc
tatacggatgctcacggtgacttgctccccctcaccaacgatgacagtttgcaccgggcc
ctggccagcgggcccccacctctgcgcctcttggttcagaaacgggcagaaggtgactcg
agtggcctggcttttgcctccaactctctacagaggcgcaagaaagggctcctgctacga
ccagtggcacctctgcgcaccaggccacccttgttaatcagcttgccccaagatttccgc
caggtgtcttcagttatagatgtggacctactacctgagacccaccgacgagtgaggctg
cacaaacatggttcagaccgtcccctgggcttctacattcgagatggcatgagtgttcgc
gtggctccccagggcctggagcgggttccaggtatcttcatctcccgcctggtacgtggg
ggcctggccgagagtacagggctgctggcggtcagtgatgagatccttgaggtcaacggc
attgaggtggccgggaagaccttggaccaagtgacggacatgatggtcgccaacagccac
aacctcatcgtcactgtcaagcctgccaaccagcgtaataatgtggtacggggggcatct
gggcgtctgacagggccttcctctgtagggcctgggcctactgatcctgacagtgacgat
gacagcagtgacctggtcattgagaatcgccaccctccttgttctaatgggctgtctcag
gggcccctgtgctgggacctgcaacctggctgcctacttcctggtgctggcagctctttg
ccctccttggatagcagggagcaagccaattctggctgggggaatggcatgcgaggcgat
gttagcggattcagcctctga

DBGET integrated database retrieval system