KEGG   Mus caroli (Ryukyu mouse): 110284837
Entry
110284837         CDS       T05910                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284837 (Fgf1)
   04014 Ras signaling pathway
    110284837 (Fgf1)
   04015 Rap1 signaling pathway
    110284837 (Fgf1)
   04390 Hippo signaling pathway
    110284837 (Fgf1)
   04151 PI3K-Akt signaling pathway
    110284837 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110284837 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284837 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110284837 (Fgf1)
   05218 Melanoma
    110284837 (Fgf1)
   05224 Breast cancer
    110284837 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110284837 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110284837 (Fgf1)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110284837 (Fgf1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110284837 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110284837
NCBI-ProteinID: XP_021006419
Ensembl: MGP_CAROLIEiJ_G0022215
LinkDB
Position
18
AA seq 172 aa
MQDFQSAEPTTAACCRAMAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPD
GTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLER
LEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcaggatttccaaagtgctgagcctaccaccgccgcttgctgccgagccatggctgaa
ggggagattacaaccttcgcagccctgaccgagaggttcaacctgcctctaggaaactac
aaaaagcccaaactgctctactgcagcaacgggggccacttcttgaggatccttcccgat
ggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctcagtgcg
gaaagcgcgggcgaagtgtatataaagggtacggagacgggccagtacttggccatggac
accgaagggcttttatacggctcgcagacaccaaatgaggaatgtctgttcctggaaagg
ctggaagaaaaccattataacacttacacctccaagaagcatgcggagaagaactggttt
gtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactatggccagaaa
gccatcttgtttctgcccctcccggtgtcttctgactag

DBGET integrated database retrieval system