KEGG   Mus caroli (Ryukyu mouse): 110284837
Entry
110284837         CDS       T05910                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284837 (Fgf1)
   04014 Ras signaling pathway
    110284837 (Fgf1)
   04015 Rap1 signaling pathway
    110284837 (Fgf1)
   04390 Hippo signaling pathway
    110284837 (Fgf1)
   04020 Calcium signaling pathway
    110284837 (Fgf1)
   04151 PI3K-Akt signaling pathway
    110284837 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110284837 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284837 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110284837 (Fgf1)
   05218 Melanoma
    110284837 (Fgf1)
   05224 Breast cancer
    110284837 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110284837 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110284837 (Fgf1)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110284837 (Fgf1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110284837 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110284837
NCBI-ProteinID: XP_021006419
Ensembl: MGP_CAROLIEiJ_G0022215
LinkDB
Position
18
AA seq 172 aa
MQDFQSAEPTTAACCRAMAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPD
GTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLER
LEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcaggatttccaaagtgctgagcctaccaccgccgcttgctgccgagccatggctgaa
ggggagattacaaccttcgcagccctgaccgagaggttcaacctgcctctaggaaactac
aaaaagcccaaactgctctactgcagcaacgggggccacttcttgaggatccttcccgat
ggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctcagtgcg
gaaagcgcgggcgaagtgtatataaagggtacggagacgggccagtacttggccatggac
accgaagggcttttatacggctcgcagacaccaaatgaggaatgtctgttcctggaaagg
ctggaagaaaaccattataacacttacacctccaagaagcatgcggagaagaactggttt
gtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactatggccagaaa
gccatcttgtttctgcccctcccggtgtcttctgactag

KEGG   Mus caroli (Ryukyu mouse): 110285629
Entry
110285629         CDS       T05910                                 

Gene name
Fgf8
Definition
(RefSeq) fibroblast growth factor 8 isoform X1
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110285629 (Fgf8)
   04014 Ras signaling pathway
    110285629 (Fgf8)
   04015 Rap1 signaling pathway
    110285629 (Fgf8)
   04020 Calcium signaling pathway
    110285629 (Fgf8)
   04151 PI3K-Akt signaling pathway
    110285629 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110285629 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285629 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    110285629 (Fgf8)
   05218 Melanoma
    110285629 (Fgf8)
   05224 Breast cancer
    110285629 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110285629 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110285629 (Fgf8)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110285629 (Fgf8)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110285629 (Fgf8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110285629
NCBI-ProteinID: XP_021007576
Ensembl: MGP_CAROLIEiJ_G0023019
UniProt: A0A6P5P1G9
LinkDB
Position
19
AA seq 268 aa
MGSPRSALSCLLLHLLVLCLQAQVRSAAQKRGPGAGDPADTLGQGHEDRPFGQRSRAGKN
FTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQV
LANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDC
VFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQ
SLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggtaaggagcgctgcgcagaagcgggggccgggcgcgggggacccagctgac
actctcgggcagggacacgaggaccgacccttcggccagcgcagcagggctggaaagaac
tttacaaatccagccccaaactaccccgaggagggatctaaggaacagagagacagtgtc
ctgcctaaagtcacacagcgacatgtgagggagcagagcctggtgacggatcagctcagc
cgccgcctcatccggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtc
ctggccaacaagcgcatcaacgccatggcagaagacggagaccccttcgcgaagctcatt
gtggagaccgatacttttggaagcagagtccgagttcgcggggcagagacaggtctctac
atctgcatgaacaagaaggggaagctaattgccaagagcaacggcaaaggcaaggactgc
gtgttcacagagatcgtgctggagaacaactacacggcgctgcagaacgccaagtacgag
ggctggtacatggcctttacccgcaagggccggccccgcaagggctccaagacgcgccag
catcagcgcgaggtgcacttcatgaagcgcctgccgcggggccaccacaccaccgagcag
agcctgcgcttcgagttccttaactacccgcccttcacgcgcagcctgcgcggcagccag
aggacttgggccccggagccccgatag

KEGG   Mus caroli (Ryukyu mouse): 110287226
Entry
110287226         CDS       T05910                                 

Gene name
Fgf16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110287226 (Fgf16)
   04014 Ras signaling pathway
    110287226 (Fgf16)
   04015 Rap1 signaling pathway
    110287226 (Fgf16)
   04020 Calcium signaling pathway
    110287226 (Fgf16)
   04151 PI3K-Akt signaling pathway
    110287226 (Fgf16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110287226 (Fgf16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110287226 (Fgf16)
  09162 Cancer: specific types
   05226 Gastric cancer
    110287226 (Fgf16)
   05218 Melanoma
    110287226 (Fgf16)
   05224 Breast cancer
    110287226 (Fgf16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110287226 (Fgf16)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110287226 (Fgf16)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110287226 (Fgf16)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110287226 (Fgf16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110287226
NCBI-ProteinID: XP_021009545
Ensembl: MGP_CAROLIEiJ_G0033322
UniProt: A0A6P5P612
LinkDB
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGXRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtcgggggcgtctttgcctccttggactgggacctgcacggcttctcctcc
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccaccttgagatcttccccaatggcacg
gtgcacggcncccgccacgaccacagccgcttcggaattctggaatttatcagcttggct
gtggggctgatcagcatcaggggagtggactctggcctgtacctaggaatgaatgagcga
ggagagctctatggatcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcctccaccttgtacaaacactcggactcggagagacag
tattatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttaccaaggccagtagatccttctaagttgccctccatgtcc
agagatctcttccgctataggtaa

KEGG   Mus caroli (Ryukyu mouse): 110289950
Entry
110289950         CDS       T05910                                 

Gene name
Fgf7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110289950 (Fgf7)
   04014 Ras signaling pathway
    110289950 (Fgf7)
   04015 Rap1 signaling pathway
    110289950 (Fgf7)
   04020 Calcium signaling pathway
    110289950 (Fgf7)
   04151 PI3K-Akt signaling pathway
    110289950 (Fgf7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110289950 (Fgf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289950 (Fgf7)
  09162 Cancer: specific types
   05226 Gastric cancer
    110289950 (Fgf7)
   05218 Melanoma
    110289950 (Fgf7)
   05224 Breast cancer
    110289950 (Fgf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110289950 (Fgf7)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110289950 (Fgf7)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110289950 (Fgf7)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110289950 (Fgf7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110289950
NCBI-ProteinID: XP_021012037
Ensembl: MGP_CAROLIEiJ_G0024235
UniProt: A0A6P5PG85
LinkDB
Position
2
AA seq 194 aa
MRKWILTGILPTLLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGLPVKGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacagggatcctgccaactctgctctacaggtcatgcttccac
ctcgtctgtctagtgggcactatatctctagcttgcaatgacatgagtccggagcaaacg
gctacgagtgtgaactgttccagccccgagcgacacaccagaagttatgactacatggaa
ggaggggatataagggtgagaagactgttctgtcgcacccagtggtacctgaggattgac
aaacgaggcaaagtgaaagggacccaggagatgaagaacagctacaacatcatggaaatc
aggaccgtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgcc
atgaacaaggaagggaaactctatgcaaagaaagaatgcaatgaggattgcaacttcaaa
gaactgattctggaaaaccattataacacctatgcatcagctaaatggacacacagcgga
ggggaaatgttcgttgccttaaatcaaaaggggcttcctgtcaaagggaagaaaacgaag
aaagaacaaaaaacagcccattttcttcctatggcaataacctaa

KEGG   Mus caroli (Ryukyu mouse): 110291557
Entry
110291557         CDS       T05910                                 

Gene name
Fgf2
Definition
(RefSeq) fibroblast growth factor 2 isoform X1
  KO
K18497  fibroblast growth factor 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04810  Regulation of actin cytoskeleton
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110291557 (Fgf2)
   04014 Ras signaling pathway
    110291557 (Fgf2)
   04015 Rap1 signaling pathway
    110291557 (Fgf2)
   04020 Calcium signaling pathway
    110291557 (Fgf2)
   04151 PI3K-Akt signaling pathway
    110291557 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110291557 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110291557 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291557 (Fgf2)
   05205 Proteoglycans in cancer
    110291557 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110291557 (Fgf2)
   05218 Melanoma
    110291557 (Fgf2)
   05224 Breast cancer
    110291557 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110291557 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110291557 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110291557 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110291557 (Fgf2)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110291557 (Fgf2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110291557 (Fgf2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 110291557
NCBI-ProteinID: XP_021014428
Ensembl: MGP_CAROLIEiJ_G0024949
UniProt: A0A6P5PFQ6
LinkDB
Position
3
AA seq 154 aa
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGHVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgccagcggcatcacctcgcttcccgcactgccggaggacggcggcgccgccttc
ccaccgggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttccta
cgcatccatcccgacggccacgtggatggcgtccgcgagaagagcgacccacacgtcaaa
ctacaactccaagcagaagagagaggagttgtgtctatcaagggagtgtgtgccaaccgg
taccttgctatgaaggaagatggacggctgctggcttctaagtgtgttacggaagagtgt
ttcttctttgaacgactggaatctaacaactacaatacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

KEGG   Mus caroli (Ryukyu mouse): 110295342
Entry
110295342         CDS       T05910                                 

Gene name
Fgf5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295342 (Fgf5)
   04014 Ras signaling pathway
    110295342 (Fgf5)
   04015 Rap1 signaling pathway
    110295342 (Fgf5)
   04020 Calcium signaling pathway
    110295342 (Fgf5)
   04151 PI3K-Akt signaling pathway
    110295342 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295342 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295342 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    110295342 (Fgf5)
   05218 Melanoma
    110295342 (Fgf5)
   05224 Breast cancer
    110295342 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110295342 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110295342 (Fgf5)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110295342 (Fgf5)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110295342 (Fgf5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110295342
NCBI-ProteinID: XP_021019515
Ensembl: MGP_CAROLIEiJ_G0027439
UniProt: A0A6P5PN58
LinkDB
Position
5
AA seq 264 aa
MSLSLLFLIFCSHLIHSAWAHGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSP
VAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVK
PKVPLSQPRRSPSPVKYRLKFRFG
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagcctgtccttgctcttcctcatcttctgcagccacctgatccacagcgcttgggct
cacggggagaagcgtctcactcccgaagggcaacccgcgcctcctaggaacccgggagac
tccagcggcagccggggcagaagtagcgcgacgttttcttcgtcttctgcctcctcacca
gtcgcagcttctccgggcagccaaggaagcggctcggaacatagcagtttccagtggagc
ccttcggggcgccggaccggcagcctatactgcagagtgggcatcggtttccatctgcag
atctatccggatggcaaagtcaatggctcccacgaagccagtgtgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacggatgactgtaagttc
agggagagattccaagaaaacagctataatacctatgcgtccgcgatccacagaactgaa
aagacaggccgggagtggtacgtggccctgaacaagagagggaaagccaagagaggctgc
agcccacgggtcaaacctcagcacgtctccacccacttcctacccaggttcaagcagtcc
gagcaaccggaactttccttcactgtcactgttccagaaaagaaaaagccaccggtgaaa
ccaaaggtgcccctgtcgcagcctcgcagaagtcccagcccagtgaagtacagactcaag
tttcgctttggatga

KEGG   Mus caroli (Ryukyu mouse): 110296943
Entry
110296943         CDS       T05910                                 

Gene name
Fgf6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110296943 (Fgf6)
   04014 Ras signaling pathway
    110296943 (Fgf6)
   04015 Rap1 signaling pathway
    110296943 (Fgf6)
   04020 Calcium signaling pathway
    110296943 (Fgf6)
   04151 PI3K-Akt signaling pathway
    110296943 (Fgf6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110296943 (Fgf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296943 (Fgf6)
  09162 Cancer: specific types
   05226 Gastric cancer
    110296943 (Fgf6)
   05218 Melanoma
    110296943 (Fgf6)
   05224 Breast cancer
    110296943 (Fgf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110296943 (Fgf6)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110296943 (Fgf6)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110296943 (Fgf6)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110296943 (Fgf6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110296943
NCBI-ProteinID: XP_021021408
Ensembl: MGP_CAROLIEiJ_G0028893
UniProt: A0A6P5PSK6
LinkDB
Position
6
AA seq 208 aa
MALGQRLFITMSRGGGRVQGTLQALVFLGVLVGMVVPSPAGARANGTLLDSRGWGTLLSR
SRAGLAGEISGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFIAMNSKGRLYTTPSFHDECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggaggaggacgtgttcagggc
acgctgcaggctctcgtcttcttaggcgtcctagtgggcatggtggtgccctcacctgcc
ggcgcccgcgccaacggcacactactggactccagaggctggggcaccctcttgtccagg
tctcgagctgggctagctggagagatttcgggtgtgaattgggaaagcggctatttggtg
ggcattaagcgacagcggagactctactgcaacgtgggcattggcttccacctccaggtg
cctcctgacggccgcatcagtggaactcacgaggagaacccctacagcctactggagatc
tccacggtagaacggggtgtggtgagcctcttcggggtgaagagtgctctcttcattgcc
atgaacagtaaaggaagactgtacacaacgcccagcttccacgacgaatgcaagttccga
gaaaccctcctcccaaacaactataacgcctacgagtcagacctgtaccgagggacctac
attgcactgagcaaatacggacgcgtaaagcggggcagcaaggtgtccccaatcatgact
gtcactcacttcctccccaggatataa

KEGG   Mus caroli (Ryukyu mouse): 110297028
Entry
110297028         CDS       T05910                                 

Gene name
Fgf23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297028 (Fgf23)
   04014 Ras signaling pathway
    110297028 (Fgf23)
   04015 Rap1 signaling pathway
    110297028 (Fgf23)
   04020 Calcium signaling pathway
    110297028 (Fgf23)
   04151 PI3K-Akt signaling pathway
    110297028 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110297028 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110297028 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297028 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    110297028 (Fgf23)
   05218 Melanoma
    110297028 (Fgf23)
   05224 Breast cancer
    110297028 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110297028 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110297028 (Fgf23)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110297028 (Fgf23)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110297028 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110297028
NCBI-ProteinID: XP_021021486
Ensembl: MGP_CAROLIEiJ_G0028894
UniProt: A0A6P5PST1
LinkDB
Position
6
AA seq 251 aa
MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGH
VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCRFRQRTL
ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRS
AEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGG
ADRCRPFPRFV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctagggacctgccttagactcctggtgggcgtgctgtgcactgtctgcagcttgggc
actgctagagcctatccggacacttccccattgcttggctccaactggggaagcctgacc
cacctgtacacggctacagccaggaccagctatcacctacagatccatagggatggtcat
gtagatggcaccccccatcagaccatctacagtgccctgatgattacatcagaggacgct
ggctctgtggtgataacaggagccatgactcgaaggttcctttgtatggatctccacggc
aacatttttggatcgcttcacttcagcccagagaattgcaggttccgccagcggacgctg
gagaatggttatgacgtctacttgtcgcagaagcatcactacctggtgagcctgggccgc
gccaagcgcatcttccagccgggcaccaacccgccgcccttctcccaattcctggcgcgc
aggaacgaggtcccgctgctgcacttctacactgttcgcccacggcgccacacgcgcagc
gccgaggacccacccgagcgcgacccactgaacgtgctcaaaccgcggccccgcgccacg
cctgtgcctgtatcctgctctcgcgagctgccgagcgcagaggaaggtggccccgcagcc
agcgatcctctgggggtgctgcgcagaggccgtggagatgctcgcgggggcgcgggaggc
gcggataggtgtcgcccctttcccaggttcgtctag

KEGG   Mus caroli (Ryukyu mouse): 110299316
Entry
110299316         CDS       T05910                                 

Gene name
Fgf4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299316 (Fgf4)
   04014 Ras signaling pathway
    110299316 (Fgf4)
   04015 Rap1 signaling pathway
    110299316 (Fgf4)
   04020 Calcium signaling pathway
    110299316 (Fgf4)
   04151 PI3K-Akt signaling pathway
    110299316 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299316 (Fgf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299316 (Fgf4)
  09162 Cancer: specific types
   05226 Gastric cancer
    110299316 (Fgf4)
   05218 Melanoma
    110299316 (Fgf4)
   05224 Breast cancer
    110299316 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110299316 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299316 (Fgf4)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110299316 (Fgf4)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299316 (Fgf4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110299316
NCBI-ProteinID: XP_021024650
Ensembl: MGP_CAROLIEiJ_G0030758
UniProt: A0A6P5Q558
LinkDB
Position
7
AA seq 202 aa
MAKRRPTTGTLLPGVLLALVVALADRGTAAPNGTRHAELGHGWDGLVARSLARLPVAAQP
PQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRG
VVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKN
GRTKKGNRVSPTMKVTHFLPRL
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgaaacgccggccgaccacagggacactgctgcccggggtcctgctggccctggtg
gtggccctggcggaccgagggaccgccgcacccaacggcacgcggcacgcagaattgggg
cacggctgggacggcttagtggcccgctcgctggcacgcctgccggtggccgcgcagccc
ccgcaggcggcggtccgcagcggcgcaggggactacctgctgggcctcaaaaggctgcgg
cggctctactgcaacgtgggcatcggattccacctgcaggtgctgcccgacggtcgcatc
ggtggtgtgcacgcagacacgagggacagtcttctggagctctctccggtgcagcgaggc
gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcagcaggggcaag
ctcttcggtgtgcctttctttacggacgagtgtaaattcaaagaaatacttctgcccaac
aattacaacgcctacgaatcctacgcgtaccccggtatgttcatggcccttagtaagaac
gggcggaccaagaaggggaatcgagtgtcgcctaccatgaaggtaacccacttccttcct
agactgtga

KEGG   Mus caroli (Ryukyu mouse): 110299358
Entry
110299358         CDS       T05910                                 

Gene name
Fgf21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04714  Thermogenesis
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299358 (Fgf21)
   04014 Ras signaling pathway
    110299358 (Fgf21)
   04015 Rap1 signaling pathway
    110299358 (Fgf21)
   04020 Calcium signaling pathway
    110299358 (Fgf21)
   04151 PI3K-Akt signaling pathway
    110299358 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299358 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    110299358 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299358 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    110299358 (Fgf21)
   05218 Melanoma
    110299358 (Fgf21)
   05224 Breast cancer
    110299358 (Fgf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110299358 (Fgf21)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299358 (Fgf21)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110299358 (Fgf21)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299358 (Fgf21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110299358
NCBI-ProteinID: XP_021024694
Ensembl: MGP_CAROLIEiJ_G0029729
UniProt: A0A6P5Q4M9
LinkDB
Position
7
AA seq 210 aa
MEWMKTRVGALGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEA
HLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPE
ACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQNPTSWGPVRFLPMPGLLHEPQDQAG
FLPPEPPDVGSSDPLSMVEPLQGRSPSYTS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggaatggatgaaaactagagttggggccctgggtctgtgggtccggctgctgctggct
gtctttctgctgggggtctaccaagcataccccatccctgactccagccccctcctccag
tttgggggccaagtccggcagaggtacctctacacagatgacgaccaggacactgaagcc
cacctggagatcagggaggatggaacagtggtaggtgcagcacaccgcagtccagaaagt
ctcctggagctcaaagccttgaagccaggggtcattcaaatcctgggtgtcaaagcctct
aggtttctttgccaacagccagatggagctctctatggatcgcctcactttgatcctgag
gcctgcagcttcagagaactgctgctggaggacggatacaatgtgtaccagtctgaagcc
catggcctgcccctgcgtctgccccagaaggactccccaaaccagaatccaacatcctgg
ggacctgtgcgcttcctgcccatgccaggcctgctccacgagccccaagaccaagcagga
ttcctgcccccagagcccccagatgtgggctcctctgaccccctgagcatggtagagcct
ttacagggccgaagccccagctatacatcctga

KEGG   Mus caroli (Ryukyu mouse): 110299386
Entry
110299386         CDS       T05910                                 

Gene name
Fgf3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299386 (Fgf3)
   04014 Ras signaling pathway
    110299386 (Fgf3)
   04015 Rap1 signaling pathway
    110299386 (Fgf3)
   04020 Calcium signaling pathway
    110299386 (Fgf3)
   04151 PI3K-Akt signaling pathway
    110299386 (Fgf3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299386 (Fgf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299386 (Fgf3)
  09162 Cancer: specific types
   05226 Gastric cancer
    110299386 (Fgf3)
   05218 Melanoma
    110299386 (Fgf3)
   05224 Breast cancer
    110299386 (Fgf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110299386 (Fgf3)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299386 (Fgf3)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110299386 (Fgf3)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299386 (Fgf3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110299386
NCBI-ProteinID: XP_021024715
Ensembl: MGP_CAROLIEiJ_G0030757
UniProt: A0A6P5Q4Q0
LinkDB
Position
7
AA seq 245 aa
MGLIWLLLLSLLEPSWPTTGPGTRLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNKRGRLYASEHYNAECEFVER
IHELGYNTYASRLYRTGSSGPGARRQPGAQRPWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLGHKDHEMVRLLQSSQPRAPGEGSQPRQRRQKKQSPGDHGKMETLSTRATPSTQLHTG
GLAVA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggcctgatctggcttctgctgctcagcttgctggaacccagctggccaactacgggg
cccgggacgcgactacgacgcgatgcgggcggccgtggtggcgtttacgagcacctcggc
ggggcgccacggcgccgcaagctctactgcgctaccaagtaccacctccagctgcacccg
agcggccgcgtgaacggcagccttgagaacagcgcctatagcatcctggagattactgcg
gtggaagtgggcgtggtggccatcaaagggctcttttctgggcggtacctggccatgaac
aagagaggacggctgtatgcttcggagcactacaacgcagagtgtgagtttgtggaacgg
atccacgagctgggctacaatacgtatgcttcccgcctgtaccgcacagggtccagtggg
ccaggagctcgacggcaacctggtgcccagagaccttggtacgtgtcggtgaatggcaag
ggtcggccacgcaggggcttcaagacccgccgcacacaaaagtcctctctcttcctgccc
cgagtgctgggccacaaggaccatgagatggtgcggctgctgcagagtagccagccacga
gccccaggagagggcagccagcccaggcagcggaggcagaagaagcagagcccaggtgat
catggcaagatggagactttgtctaccagggccactccaagcacccagctgcatacaggt
ggactggctgtggcctga

KEGG   Mus caroli (Ryukyu mouse): 110299450
Entry
110299450         CDS       T05910                                 

Gene name
Fgf19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299450 (Fgf19)
   04014 Ras signaling pathway
    110299450 (Fgf19)
   04015 Rap1 signaling pathway
    110299450 (Fgf19)
   04020 Calcium signaling pathway
    110299450 (Fgf19)
   04151 PI3K-Akt signaling pathway
    110299450 (Fgf19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299450 (Fgf19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299450 (Fgf19)
  09162 Cancer: specific types
   05226 Gastric cancer
    110299450 (Fgf19)
   05218 Melanoma
    110299450 (Fgf19)
   05224 Breast cancer
    110299450 (Fgf19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110299450 (Fgf19)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299450 (Fgf19)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110299450 (Fgf19)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299450 (Fgf19)
SSDB
Motif
Pfam: FGF Fascin DUF3458
Other DBs
NCBI-GeneID: 110299450
NCBI-ProteinID: XP_021024798
Ensembl: MGP_CAROLIEiJ_G0030759
UniProt: A0A6P5Q4X4
LinkDB
Position
7
AA seq 218 aa
MARKWNGRAVARALVLATLWLAVSGRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGP
YVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLI
RYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFET
GDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgagaaagtggaacgggcgtgcggtggcccgagccctggtcctggccactctgtgg
ctggctgtgtctgggcgtcccctggcccagcaatcccagtctgtgtcagatgaagatcca
ctctttctctatggctggggcaagattacccgccttcagtacctgtactccgctggtccc
tatgtctccaactgcttcctccgaatccggagcgacggctctgtggactgcgaggaggac
caaaacgaacgaaatttgttggaattccgcgcggtcgctttgaagaccattgccatcaag
gacgtcagcagcgtgcggtacctctgcatgagtgcggacggcaagatatacgggctgatt
cgctactcggaggaagactgtaccttcagggaggaaatggactgtttaggctacaaccag
tacagatccatgaagcaccatctccatatcatcttcatccaggccaagcccagagagcag
ctccaggaccagaaaccctcaaactttatccccgtgtttcaccgctccttctttgaaacc
ggggaccagctgaggtctaaaatgttctccctgcccctggagagtgacagcatggatccg
ttcaggatggtggaggatgtagaccacctagtgaagagtcccagcttccagaaatga

KEGG   Mus caroli (Ryukyu mouse): 110300580
Entry
110300580         CDS       T05910                                 

Gene name
Fgf20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110300580 (Fgf20)
   04014 Ras signaling pathway
    110300580 (Fgf20)
   04015 Rap1 signaling pathway
    110300580 (Fgf20)
   04020 Calcium signaling pathway
    110300580 (Fgf20)
   04151 PI3K-Akt signaling pathway
    110300580 (Fgf20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110300580 (Fgf20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300580 (Fgf20)
  09162 Cancer: specific types
   05226 Gastric cancer
    110300580 (Fgf20)
   05218 Melanoma
    110300580 (Fgf20)
   05224 Breast cancer
    110300580 (Fgf20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110300580 (Fgf20)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110300580 (Fgf20)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110300580 (Fgf20)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110300580 (Fgf20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110300580
NCBI-ProteinID: XP_021026463
Ensembl: MGP_CAROLIEiJ_G0030991
UniProt: A0A6P5Q8X8
LinkDB
Position
8
AA seq 211 aa
MAPLTEVGAFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHL
HGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttgaccgaagtcggggctttcttgggcggcctggagggcttgggccagcag
gtggggtcgcacttcttgctgcctcctgcaggggagaggccaccgctgttaggggagcgg
cggggcgcgttggagcggggcgcccgcggcgggccgggttccgtggagctggcgcacctg
catgggatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcaccgtgcagggcacccggcaggatcacagtctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtatcagaggtgtggacagtggcctgtaccttggg
atgaatgacaaaggagaactttatggatcagagaaattgacttctgaatgcatcttcagg
gaacaatttgaagagaactggtataatacctattcgtccaacatatataaacatggagac
acgggtcgaaggtattttgtagcacttaacaaggatggaactccaagagatggtgccagg
tccaaaagacatcaaaagtttacccactttttaccaagaccagtagacccagaaagagtt
ccagaattatacaaagacctactgatgtacacttga

KEGG   Mus caroli (Ryukyu mouse): 110303818
Entry
110303818         CDS       T05910                                 

Gene name
Fgf22
Definition
(RefSeq) fibroblast growth factor 22 isoform X1
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110303818 (Fgf22)
   04014 Ras signaling pathway
    110303818 (Fgf22)
   04015 Rap1 signaling pathway
    110303818 (Fgf22)
   04020 Calcium signaling pathway
    110303818 (Fgf22)
   04151 PI3K-Akt signaling pathway
    110303818 (Fgf22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110303818 (Fgf22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303818 (Fgf22)
  09162 Cancer: specific types
   05226 Gastric cancer
    110303818 (Fgf22)
   05218 Melanoma
    110303818 (Fgf22)
   05224 Breast cancer
    110303818 (Fgf22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110303818 (Fgf22)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110303818 (Fgf22)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110303818 (Fgf22)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110303818 (Fgf22)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110303818
NCBI-ProteinID: XP_021030700
Ensembl: MGP_CAROLIEiJ_G0015539
UniProt: A0A6P5QL39
LinkDB
Position
10
AA seq 162 aa
MRSRLWLGLAWLLLARAPGAPGGYPHLEGDVRWRRLFSSTHFFLRVDLGGRVQGTRWRHG
QDSIVEIRSVRVGTVVIKAVYSGFYVAMNRRGRLYGSRVYSVDCRFRERIEENGYNTYAS
RRWRHRGRPMFLALDSQGIPRQGRRTRRHQLSTHFLPVLVSS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgcagccgcctctggctgggcctagcctggctgctgctggcgcgggcaccgggcgct
ccgggagggtacccgcatctggagggcgacgtgcgctggcgccgcctcttctcctccact
cactttttcctgcgtgtggaccttggtggtcgggtgcaggggacgcgttggcggcacggc
caggacagtatagtggagatccgttctgtccgtgtgggcactgtggtgatcaaagctgtg
tactcaggcttctatgtggccatgaatcgcaggggccgcctctatgggtcgcgggtctac
tctgtggactgtaggttccgggagcgcatcgaggagaacggctacaacacatacgcctct
cgacgttggaggcaccgcggccgacccatgttcctggcacttgacagccaaggcattccc
aggcaaggcagacggacgcgacgacaccaactgtccacacacttcctgccagtcctggtc
tcgtcttga

KEGG   Mus caroli (Ryukyu mouse): 110305760
Entry
110305760         CDS       T05910                                 

Gene name
Fgf18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110305760 (Fgf18)
   04014 Ras signaling pathway
    110305760 (Fgf18)
   04015 Rap1 signaling pathway
    110305760 (Fgf18)
   04020 Calcium signaling pathway
    110305760 (Fgf18)
   04151 PI3K-Akt signaling pathway
    110305760 (Fgf18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110305760 (Fgf18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305760 (Fgf18)
  09162 Cancer: specific types
   05226 Gastric cancer
    110305760 (Fgf18)
   05218 Melanoma
    110305760 (Fgf18)
   05224 Breast cancer
    110305760 (Fgf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110305760 (Fgf18)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110305760 (Fgf18)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110305760 (Fgf18)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110305760 (Fgf18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110305760
NCBI-ProteinID: XP_021033512
Ensembl: MGP_CAROLIEiJ_G0016191
UniProt: A0A6P5QSS3
LinkDB
Position
11
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacactttctactgctgtgcttc
caggttcaggtgttggcagccgaggagaatgtggacttccgcatccacgtggagaaccag
acgcgggctcgagatgatgtgagtcggaagcagctgcgcttgtaccagctctatagcagg
accagtgggaagcacattcaagtcctgggccgtaggatcagtgcccgtggcgaggacggg
gacaagtatgcccagctcctagtggagacagataccttcgggagtcaagtccggatcaag
ggcaaggagacagaattctacctgtgtatgaaccgaaaaggcaagctcgtggggaagcct
gatggtactagcaaggagtgcgtgttcattgaaaaggttctggaaaacaactacacggcc
ctgatgtctgccaagtactctggctggtacgtgggcttcaccaagaaggggcggcctcgc
aagggtcccaagacccgcgagaaccagcaagatgtacacttcatgaagcgttaccccaag
ggacaggccgagctgcagaagcccttcaagtacaccacagtcaccaagcgatccaggcgg
atccgccccactcaccccggctag

KEGG   Mus caroli (Ryukyu mouse): 110308330
Entry
110308330         CDS       T05910                                 

Gene name
Fgf10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110308330 (Fgf10)
   04014 Ras signaling pathway
    110308330 (Fgf10)
   04015 Rap1 signaling pathway
    110308330 (Fgf10)
   04020 Calcium signaling pathway
    110308330 (Fgf10)
   04151 PI3K-Akt signaling pathway
    110308330 (Fgf10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110308330 (Fgf10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308330 (Fgf10)
  09162 Cancer: specific types
   05226 Gastric cancer
    110308330 (Fgf10)
   05218 Melanoma
    110308330 (Fgf10)
   05224 Breast cancer
    110308330 (Fgf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110308330 (Fgf10)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110308330 (Fgf10)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110308330 (Fgf10)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110308330 (Fgf10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110308330
NCBI-ProteinID: XP_021036454
Ensembl: MGP_CAROLIEiJ_G0018923
UniProt: A0A6P5R042
LinkDB
Position
13
AA seq 209 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNCSSSSSSFSS
PSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIG
VVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVA
LNGKGAPRRGQKTRRKNTSAHFLPMTIQT
NT seq 630 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgccgggctgctgt
tgctgcttcttgttgctcttcttggtgtcttcggtccctgtcacctgccaagctcttggt
caggacatggtgtcaccggaggccaccaactgctcttcttcctcctcgtccttctcctct
ccttccagtgcgggaaggcatgtgcggagctacaatcacctccaaggagatgtccgctgg
agaaggttgttctccttcaccaagtactttctcacgattgagaaaaacggcaaggtcagc
gggaccaagaatgaagactgtccgtacagtgtcctagagataacatcagtggaaatcgga
gttgttgccgtcaaagccatcaacagcaactattacttagccatgaacaagaaggggaaa
ctctatggctcaaaagaatttaacaacgactgtaagctgaaagagagaatagaggaaaat
ggatacaacacctatgcatcttttaactggcagcacaatggcaggcaaatgtacgtggca
ttgaatggaaaaggagctcccaggagaggacaaaaaacaagaaggaaaaacacctctgct
cacttcctccccatgacaatccaaacatag

KEGG   Mus caroli (Ryukyu mouse): 110308847
Entry
110308847         CDS       T05910                                 

Gene name
Fgf17
Definition
(RefSeq) fibroblast growth factor 17 isoform X1
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110308847 (Fgf17)
   04014 Ras signaling pathway
    110308847 (Fgf17)
   04015 Rap1 signaling pathway
    110308847 (Fgf17)
   04020 Calcium signaling pathway
    110308847 (Fgf17)
   04151 PI3K-Akt signaling pathway
    110308847 (Fgf17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110308847 (Fgf17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308847 (Fgf17)
  09162 Cancer: specific types
   05226 Gastric cancer
    110308847 (Fgf17)
   05218 Melanoma
    110308847 (Fgf17)
   05224 Breast cancer
    110308847 (Fgf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110308847 (Fgf17)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110308847 (Fgf17)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110308847 (Fgf17)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110308847 (Fgf17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 110308847
NCBI-ProteinID: XP_021036810
Ensembl: MGP_CAROLIEiJ_G0019491
UniProt: A0A6P5QY78
LinkDB
Position
14
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcctaaccttaccctgtgcttgcagctattgattctctgc
tgtcaaacgcagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgctatgaccgaccagctgagcaggcggcaaatccgtgaataccagctctacagccgg
accagtggcaagcacgtgcaggtcaccggacgtcgcatctctgccaccgcagaggatggc
aacaagttcgccaagctcatcgtggagacagatacattcggcagcagagtccgcatcaag
ggggcagagagcgagaagtacatctgtatgaacaagaggggcaagctgattgggaagccg
agcgggaagagcaaagactgcgtgttcaccgagatcgtactggagaataactacacggcc
ttccagaacgcccggcacgagggctggttcatggctttcactcggcagggccggccacgc
caggcctcccggagccgccagaaccagcgagaggcccacttcatcaagcgcctctaccaa
ggccagctgccttttcccaaccacgctgaaaggcagaagcagttcgaattcgtgggctcc
gcccccactcgcaggaccaagcgcactcggaggccccagtcccaaacgtag

KEGG   Mus caroli (Ryukyu mouse): 110309422
Entry
110309422         CDS       T05910                                 

Gene name
Fgf9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110309422 (Fgf9)
   04014 Ras signaling pathway
    110309422 (Fgf9)
   04015 Rap1 signaling pathway
    110309422 (Fgf9)
   04020 Calcium signaling pathway
    110309422 (Fgf9)
   04151 PI3K-Akt signaling pathway
    110309422 (Fgf9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110309422 (Fgf9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309422 (Fgf9)
  09162 Cancer: specific types
   05226 Gastric cancer
    110309422 (Fgf9)
   05218 Melanoma
    110309422 (Fgf9)
   05224 Breast cancer
    110309422 (Fgf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110309422 (Fgf9)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110309422 (Fgf9)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110309422 (Fgf9)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110309422 (Fgf9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110309422
NCBI-ProteinID: XP_021037723
Ensembl: MGP_CAROLIEiJ_G0019358
UniProt: A0A6P5QTI5
LinkDB
Position
14
AA seq 208 aa
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg
aacgtaccggtgttgccggtggacagtccggtgttgctaagtgaccacctgggtcagtcc
gaagcaggggggctgccccggggccccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctgtactgcaggactggatttcatttagagatcttccccaacggt
actatccagggaaccaggaaagaccacagccgcttcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgcggtgtggacagtggactctacctcggcatgaacgag
aagggggagctgtatggatcagaaaaactaacacaggaatgtgtgttcagagaacagttt
gaagagaactggtacaacacttactcttccaacctctataaacatgtggacaccggaagg
agatactatgttgcattaaataaggatgggactccaagagaagggaccaggactaaacgg
caccagaaatttacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagctga

DBGET integrated database retrieval system