KEGG   Mus caroli (Ryukyu mouse): 110284850
Entry
110284850         CDS       T05910                                 

Gene name
Ctnna1
Definition
(RefSeq) catenin alpha-1 isoform X1
  KO
K05691  catenin alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04670  Leukocyte transendothelial migration
mcal05100  Bacterial invasion of epithelial cells
mcal05200  Pathways in cancer
mcal05213  Endometrial cancer
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110284850 (Ctnna1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110284850 (Ctnna1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110284850 (Ctnna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284850 (Ctnna1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110284850 (Ctnna1)
   05213 Endometrial cancer
    110284850 (Ctnna1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110284850 (Ctnna1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110284850 (Ctnna1)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110284850 (Ctnna1)
SSDB
Motif
Pfam: Vinculin I_LWEQ FUSC
Other DBs
NCBI-GeneID: 110284850
NCBI-ProteinID: XP_021006440
Ensembl: MGP_CAROLIEiJ_G0022104
UniProt: A0A6P5P2H3
LinkDB
Position
18
AA seq 906 aa
MTAVHTGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDAAQHQGGSGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgccgtccacacaggcaacataaacttcaaatgggaccccaaaagtctggagatt
aggactctggctgttgaaagactgttggagcctcttgttacacaggttacaaccctggta
aacaccaatagtaaagggccctctaataaaaagagaggccgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggaaaagggggataaaattgca
aaagagagccagtttctcaaggaggagcttgtggttgctgtagaagatgttcgaaaacaa
ggagatttgatgaagagcgctgctggggagtttgcagatgatccatgctcttctgtgaag
cgaggcaacatggtccgggcagctcgagctttgctctctgccgtcacccggctgctgatt
ctggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atattgaaactgaggaatgctggcaatgaacaagacttagggatacagtacaaagctctg
aaaccagaagtagataagctgaacatcatggcagcaaaaagacagcaggaactaaaagat
gtgggcaatcgtgatcagatggctgcagctagaggaatcctgcagaaaaatgttccaatc
ctctatactgcatcccaggcatgcctacaacaccctgatgttgcagcctataaggccaac
cgggacttgatatacaagcagctgcagcaggccgtcacaggaatttctaatgcagcccag
gctactgcatcagatgatgctgcccagcaccagggtggcagtggcggagagctggcatac
gctctcaacaactttgataaacaaatcattgtggaccctctgagcttcagcgaggagcgc
tttaggccgtccctggaggagcgcctggaaagcattattagtggggctgccctgatggct
gactcatcctgcacacgtgatgaccgtcgggagcgcattgtggcagagtgtaatgctgtc
cgccaggctctacaggacctgctctcagaatacatgggcaacgctggacgtaaagaaaga
agtgatgcactcaactctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagcttcgcaaagctgtcatggaccacgtatcagactctttcctggagaccaatgtccct
ctgttagtactgattgaagctgcaaagaatggaaatgagaaagaagttaaggaatatgcc
caagtttttcgtgaacatgccaacaaactgattgaggttgccaacctggcctgttcaatc
tccaacaatgaagaaggcgtgaagcttgtccgaatgtctgcaagccagttagaagcactg
tgtcctcaggttatcaatgctgcattggctttagcagcaaagccacagagtaaactggcc
caagagaacatggatctttttaaagagcaatgggaaaagcaagtccgtgttctcacagat
gctgttgatgacattacttccatcgatgacttcttggctgtctcagagaaccacatttta
gaagatgtgaacaagtgtgttattgctctccaagagaaagatgtggatgggctggatcgc
actgccggtgccatccgaggccgggcagcccgagtcattcatgtagtcacctcagagatg
gacaactacgagccaggagtttacacagagaaggttctggaagccaccaagctcctctcc
aacacagtcatgccgcgcttcactgagcaggtggaagcagctgtggaagccctcagctcg
gacccggcccagcccatggatgagaatgagttcatcgacgcctcccgtctggtgtacgac
ggcatccgggacatccggaaagcagtgctgatgataaggacccccgaggagttggacgac
tctgacttcgagactgaagactttgatgtcagaagcaggaccagtgtccagacagaagat
gaccagctgatagctggccagagcgcccgggcgatcatggctcagcttcctcaggagcaa
aaagcaaagattgcagaacaggtggccagtttccaggaagagaagagcaagctggatgct
gaagtgtccaagtgggatgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgatcatgatggagatgaccgacttcacccgaggcaaagggccactcaaaaacacctct
gatgtgatcagtgctgccaagaaaattgcggaggcgggatccaggatggacaagctcggc
cggaccatcgcagaccactgcccagactcggcatgcaagcaggacctgctggcctacctt
cagcgcatcgctctctactgccaccagctcaacatctgcagcaaagtcaaggctgaagta
cagaaccttggtggagagcttgtcgtctctggggtggacagcgccatgtccctgatccag
gcagccaagaacttgatgaatgctgttgtgcagacagtgaaggcgtcctacgtggcttcc
accaaataccagaagtcacaggggatggcgtctctgaaccttcctgctgtgtcatggaag
atgaaggcccctgagaagaagccgttggtgaagagagagaagcaggatgagacgcagacc
aagattaagcgagcttctcagaagaaacacgtgaaccctgtgcaggccctgagcgagttc
aaagccatggacagcatctga

KEGG   Mus caroli (Ryukyu mouse): 110295850
Entry
110295850         CDS       T05910                                 

Gene name
Ctnna2
Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04670  Leukocyte transendothelial migration
mcal05100  Bacterial invasion of epithelial cells
mcal05200  Pathways in cancer
mcal05213  Endometrial cancer
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110295850 (Ctnna2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110295850 (Ctnna2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110295850 (Ctnna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295850 (Ctnna2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110295850 (Ctnna2)
   05213 Endometrial cancer
    110295850 (Ctnna2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110295850 (Ctnna2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110295850 (Ctnna2)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110295850 (Ctnna2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 110295850
NCBI-ProteinID: XP_021019871
Ensembl: MGP_CAROLIEiJ_G0028517
UniProt: A0A6P5Q089
LinkDB
Position
6
AA seq 966 aa
MTDIHSSYTYTGSMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPS
GKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIAS
SEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNAT
NEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAF
LRHPDVAATRANRDYVFKQVQEAIAGISSAAQATSPTDEAKGHTGIGELAAALNEFDNKI
ILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLS
EYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAK
SGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAAL
TLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIA
LQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAE
QVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDY
DVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDS
GNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCP
DSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDV
IDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVAS
TKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEF
KAMDSF
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgacagatattcactcaagctacacatatacagggagcatgacttcggcaacttcacct
attattttaaaatgggatcccaaaagtttggaaatccggacactcacagtggaaagacta
ttggagccacttgtgacacaggtaacaacgcttgtcaacacaagcaacaaaggtccgtct
ggtaaaaagaaagggaggtcaaagaaagcccatgtgctggcagcatctgtagaacaagct
actcagaacttcctggaaaagggtgaacagatcgctaaggagagccaagacctcaaagaa
gagttggtggctgctgtagaggatgtgcggaagcaaggtgagacaatgcggatcgcctcc
tcagagtttgcagatgacccttgctcttcggtcaagcgtggcaccatggtgcgtgcagca
agggctctgctatcggctgtgacacgcttgctcatcctggccgacatggcagatgtcatg
aggcttttatcgcatctgaaaattgttgaggaggccttggaagcagtcaaaaatgctaca
aatgaacaagaccttgcaaaccgctttaaagagtttgggaaagagatggtgaaactgaac
tatgtagcagcaagacggcagcaggagctgaaggaccctcactgtagggatgagatggct
gcagcccgtggagctctgaagaagaatgccaccatgctatacacagcctcccaagccttc
ctccggcatccagatgttgctgctacaagggccaaccgagattatgtatttaaacaagtc
caagaggccatcgctggcatctccagtgctgctcaggccacctcccccaccgatgaagcc
aaaggccacacaggcatcggcgagctggctgcagccctgaatgagtttgataataagatc
atcctggaccccatgacgttcagcgaggccaggttccggccgtccctggaggagagactg
gagagcatcatcagtggggctgctctcatggcggattcctcctgcacacgtgatgaccgc
cgtgagcgtattgtggccgagtgcaatgcagttcgccaggcactccaggacctgctaagc
gagtacatgaataacactggaaggaaagagaaaggagaccctctcaacattgcgattgac
aagatgaccaagaaaacaagagatctgaggagacagcttcggaaagctgtgatggatcac
atatcagattctttcttggaaactaatgtccctttgctggttctcattgaggctgcgaag
agtgggaatgagaaggaggtgaaggaatatgcccaagttttccgtgaacatgccaacaag
ctggtggaggttgccaatttggcttgttccatctccaacaatgaggaaggggtgaaatta
gtcaggatggcagccacccagattgacagcctgtgtccccaggtcattaatgctgccctc
acactggctgctcggccacagagtaaagttgctcaggacaacatggatgtcttcaaagac
cagtgggaaaagcaggtccgggtgctcactgaggcagtggatgacatcacctctgtggat
gacttcctctctgtctcagaaaaccatatcttggaggatgtgaacaaatgtgtgattgcg
ctgcaagagggagacgtagacacactggatcgcacagctggggccatacggggccgggca
gcccgggtcattcacatcatcaatgcagagatggagaattatgaagctggggtctatacg
gagaaagtgctggaagccacaaaattgctttcagaaacagtgatgccacgctttgctgaa
caagttgaggtggccatcgaagccctgagcgccaatgtccctcagccgttcgaggagaac
gagttcatcgatgcctcgcgcctggtgtatgatggtgttcgggacatcagaaaggctgtg
ctgatgatcaggactccagaagagctagaagacgattccgactttgagcaagaggattat
gatgtgcggagtcggacaagtgttcagacagaggatgaccagctcattgctggacagagt
gcacgggccatcatggcgcaactaccacaggaggagaaagcaaaaatagctgaacaggtg
gagattttccaccaagaaaaaagcaagctggatgctgaagtggccaagtgggatgacagc
ggcaatgacatcattgtgctggccaagcagatgtgtatgatcatgatggagatgacagac
ttcacaagaggcaaaggcccactgaaaaatacatctgatgtcattaatgctgccaagaag
attgcagaagcaggctctcgaatggacaaattagcacgcgctgtggctgatcagtgtcct
gattcagcatgtaagcaggatttattagcctaccttcagcggattgccttgtactgccat
cagcttaacatctgcagcaaagtgaaggctgaggttcagaacctaggaggagagctcatt
gtgtcagggacaggagttcagagcactttcactaccttttatgaggtagattgtgatgtc
atagatgggggcagggctagtcaactttctacccacctcccaacctgtgctgagggagct
ccaatcgggagtggaagcagtgactcctccatgctggacagtgctacatcactcatccag
gcagccaaaaacctgatgaatgctgttgtcctcacggtgaaagcatcttatgtagcctca
actaaataccagaaggtctatggaacagcagctgtcaactctccagttgtgtcttggaag
atgaaggctcctgaaaagaagccccttgtgaagagagaaaagcctgaagaatttcagaca
agagttagacgagggtctcaaaagaaacacatttcacctgtgcaggctttaagtgaattc
aaggcaatggattccttctag

KEGG   Mus caroli (Ryukyu mouse): 110302662
Entry
110302662         CDS       T05910                                 

Gene name
Ctnna3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04670  Leukocyte transendothelial migration
mcal05100  Bacterial invasion of epithelial cells
mcal05200  Pathways in cancer
mcal05213  Endometrial cancer
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110302662 (Ctnna3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110302662 (Ctnna3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110302662 (Ctnna3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302662 (Ctnna3)
  09162 Cancer: specific types
   05226 Gastric cancer
    110302662 (Ctnna3)
   05213 Endometrial cancer
    110302662 (Ctnna3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110302662 (Ctnna3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110302662 (Ctnna3)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110302662 (Ctnna3)
SSDB
Motif
Pfam: Vinculin TMEM89
Other DBs
NCBI-GeneID: 110302662
NCBI-ProteinID: XP_021029115
Ensembl: MGP_CAROLIEiJ_G0015403
UniProt: A0A6P5QFN7
LinkDB
Position
10
AA seq 895 aa
MSAETPITMNMDTQDLQIQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLA
SVEEATWNLLDKGEMIAKEATVLKEELAAALQEVRKESKALKVSAERFTDDPCYLPKREA
VVQAARALLAAVTKLLVLADMIDVMCXLQHVSSFQRTFESLKNVSNKSDLQRTYQKLGKE
LESLDYLAFKRQQDLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALDVISNASQGIQNVPAPPEPQAATLGSALDELESLIVLNPLTVTEEDVRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMSNTGKTERSNTLN
TAIVNMSKKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHE
HTGRLVEVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTME
MYKRTWEHYIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALDALSKNSLTA
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEDDHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSAG
PRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtccgcagaaacgccaataaccatgaatatggacactcaggatctgcagatccaaacg
ttcactgtggagaaactgctggagcctctgataatccaggttactaccctggtgaattgt
ccgcagaatccttccaacaggaagaaaggacgttcaaagagagccagagttcttctagct
tctgtggaggaagcaacttggaatttgttagacaagggggagatgattgctaaggaagcc
acggttttaaaggaagagctggcagctgcactccaggaagttcggaaagagagcaaagct
ctgaaggtatcagctgagagatttacagacgacccctgttacctcccgaaaagggaggcc
gtggttcaagccgcccgcgccctgttggcagcagttacaaaactccttgttcttgccgac
atgattgatgtcatgtgcntcttgcagcatgtgtcatctttccaaagaacattcgagtct
ctcaaaaatgtttccaacaagtccgacctccagagaacctaccagaagctcgggaaggag
ctggaaagcctggattatttggccttcaaacgccagcaggacttaaaatctccaagccag
agggatgaaattgcaggggcccgggccaccttgaaggagaactccccactcctgcattca
atttgttcagcatgcttggaacattccgatgttgcttcgctcaaagccagtaaggacacc
gtctgtgaagagatccagaacgctcttgatgtcatttcaaatgcttcccaaggcatccag
aatgtgccagcgccccctgaacctcaggcagcaacactgggaagtgctcttgatgagttg
gagagcttaattgtcctgaacccactcacagtgacagaggaagacgtaagaccatcacta
gagaaacgcctagaagccatcatcagtggggccgcactgttggccgactcgtcctgcacc
agggacctccaccgggagcggatcatcgccgagtgcaatgccatccgccaggcgctccag
gacctgctgtcggagtacatgagtaacactggaaaaacagaaaggagtaataccctgaat
actgccattgtcaacatgagcaagaagacaagagacctccgccgacagctccgcaaagct
atcatagatcacatatcagattctttcttggatacaacagttccactcctggtcctcatt
gaagctgcgaagaatggccgagtcaaggaaatcaaagactatgctgccatatttcatgag
cacactggcaggcttgtggaggtggcaaatctggcttgttccatgtcaacgaatgaagat
gggattaaaatcgtcagaattgcagccaatcacctggagaccctgtgtccacagatcata
aatgctgcacttgctttggcatcaagacccaagagtcaagtggtcaaaaacaccatggaa
atgtacaagcgcacatgggaacactacatccacgtcctcactgaagctgtggatgacatc
accagcattgacgactttctggctgtatctgaaagccacatcctggaagatgtcaacaaa
tgcattatagccttgagagatcaggatgctgataatttagaccgagctgctggtgccatc
agaggacgggccgcaagagtagctcacatcgttgcgggtgaaatggatagttatgaacct
ggcgcttacactgaaggtgtgatgagaaatgtcaacttccttacaagcactgtgatccca
gagttcgtgacacaagtgaatgtggccctagatgctttaagcaagaactctctgactgct
cttgatgataatcagtttgtggacatctccaagaagatctatgacacaatccatgatatc
aggtgttcggtcatgatgattcggacaccagaggaactagaggatgtttctgaccttgaa
gatgaccatgaggtccgtagccacaccagcattcagacagaagggaaaactgatcgggcc
aagatgactcaactgcctgaggcagaaaaggaaaagattgctgagcaagtcgccgacttc
aagaaggtgaagagcaagctggacgcagagattgagatatgggatgacacaagcaatgac
atcattgttcttgccaagaagatgtgcatgatcatgatggagatgaccgacttcacgagg
gggaaaggaccactaaagcataccactgatgtaatctatgcagctaaaatgatatcagag
tcaggatcaaggatggatgttcttgctcggcagattgctaaccagtgtccagatccacct
tgcaaacaggacttgctggcttacctggaacagattaaattctactcccaccagctgaaa
atctgcagtcaagttaaagcagagatccaaaacctggggggagaactcattgtatcagct
ttggacagtgtcacctccctgatccaggcagccaagaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcatacattgcctccaccaagatcatccgcatccagagttctgcagga
ccccggcacccagttgtcatgtggaggatgaaggctccggctaagaagcccttgattaaa
agagagaagccagaagaaacatgggcagctgtcagaagaggctctgccaagaaaaagatc
cacccagttcaagtcatgagtgaattcagagggagacaagtctactga

DBGET integrated database retrieval system