KEGG   Mus caroli (Ryukyu mouse): 110284880
Entry
110284880         CDS       T05910                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110284880 (Pdgfrb)
   04014 Ras signaling pathway
    110284880 (Pdgfrb)
   04015 Rap1 signaling pathway
    110284880 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    110284880 (Pdgfrb)
   04020 Calcium signaling pathway
    110284880 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    110284880 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    110284880 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110284880 (Pdgfrb)
   04540 Gap junction
    110284880 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110284880 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284880 (Pdgfrb)
   05206 MicroRNAs in cancer
    110284880 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    110284880 (Pdgfrb)
   05231 Choline metabolism in cancer
    110284880 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    110284880 (Pdgfrb)
   05218 Melanoma
    110284880 (Pdgfrb)
   05215 Prostate cancer
    110284880 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110284880 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110284880 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110284880 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110284880 (Pdgfrb)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110284880 (Pdgfrb)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110284880 (Pdgfrb)
CD molecules [BR:mcal04090]
 Proteins
  110284880 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 110284880
NCBI-ProteinID: XP_021006487
Ensembl: MGP_CAROLIEiJ_G0022318
UniProt: A0A6P5NZ10
LinkDB
Position
18
AA seq 1098 aa
MGLSGVMPASVLRGQLLLSLLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELNERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINITVIENGYVRLLETLGDVEIAKLHRSRTLRVIFEAYPTPSVLWLKDNRTLGDSG
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRVFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQIIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEDDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALP
VGFSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDY
IIPLPDPKPDAADEGLPEGSPSLASSTLNEANTSSTISCDSPLELQEEPQQAEPEAQLEQ
PQDSGCPEPLAEAEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgggactttcaggagtgatgccagcttcagtcctcagaggccagttgttgctgtccctg
ttatggctcctgggaccacagacctcccggggcctagtcatcacgccccctgggccagag
tttgtcctcaacatctccagcacctttgttctgacctgctcgagttcagctccggtgatg
tgggaacagatgtcccaggtgccctggcaagaagcagccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcactgggggagacactggggaatacttttgtgtc
tacaacaactcgctagggccggagctcaatgagaggaagcgtatctatatcttcgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccagctggaggtaacgctacat
gagaagaaagtggacatccccctgcatgtaccctacgaccaccagcgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactacgtctacagcctccaggtgtcatccatcaacgtctctgtgaatgccgtg
cagactgtggtccgccagggtgagagcatcaccatcaggtgcattgtgatgggcaatgat
gtggtgaacttccaatggacatacccccgcatgaagagtgggcggctggtggagccagtg
acagactacctctttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgattcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatgga
gatgaaaaagccatcaacatcactgtgatcgagaatggctacgtgcggctgctggaaaca
ctgggagatgtagaaattgctaagctgcaccggagccggacgctgcgggtgatatttgag
gcttatccgacgccctctgtcctgtggctcaaggacaaccgtaccttgggcgactccggc
gctggcgagttagttctgtctactcgcaacgtgtctgagacccggtacgtgtcagaactg
accctggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagtcttccacgag
gacgatgaggtccagctctccttcaagctgcaggtcaatgtccccgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagataatccgctgtcgtggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccacgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaatgtgact
ttctgggaggacgatcaggaatacgaggtggtgagcacactgcgtctgcgccacgtggat
cagccactgtccgtacgctgcatgctgcagaactccatgggcggagattcgcaggaggtc
accgtggtcccacattccttgcccttcaaagtggtggtgatctcagccatcctggcctta
gtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggtcatgagtacatctac
gtggaccctgtgcagttgccttacgactccacgtgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccacggctcacggt
ctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatcaacagccaga
agtagcgagaagcaagccttaatgtcggagctgaagattatgagtcaccttggaccccac
ctgaacgtggtcaacctgctgggggcctgcaccaaaggagggcccatctacatcatcacg
gaatactgccgctacggtgacctggtggactatctgcaccggaacaaacacaccttcttg
cagcgacactccaacaagcattgtccgccaagtgctgagctctacagcaacgccctgcca
gtggggttctccctacccagccacttgaacctgactggggagagtgacggtggctacatg
gatatgagcaaggatgaatctgtagattacgtgcccatgttggacatgaaaggagacatc
aaatatgcagacattgagtcctccagctacatggccccttatgataactatgtcccatct
gcccctgaaaggacctatcgtgccaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagctaccaagtggccaacggcatggacttcttagcctctaagaac
tgtgttcaccgagacttggcggccaggaatgtgctcatctgcgagggcaagctggtcaag
atctgtgactttggcctggctcgagacatcatgagggactcaaactacatctccaaaggc
agtacctttctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
accttgagtgatgtgtggtcttttgggatcctactctgggagatcttcacactgggtggt
accccttacccagagctgcccatgaacgaccagttttacaatgccatcaagaggggctac
cgcatggcccagcctgctcatgcctcggatgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaaataccagcaggtagacgaggagttcctgaggagtgac
catccggccatcctgaggtcccaagcccgctttccggggatccacagcctccgatcccct
ctggacaccagctctgttctctacactgccgtgcagcccaatgagagtgacaatgactac
atcatccccttacctgaccccaagcctgacgctgctgatgaaggtctcccagaggggtcc
cccagccttgccagttccaccttgaatgaagccaacacttcctccaccatctcctgcgac
agtcccctggagctccaagaagagccacagcaagcagagcctgaggcacaactggagcag
ccacaggattcaggctgcccagaacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus caroli (Ryukyu mouse): 110295292
Entry
110295292         CDS       T05910                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295292 (Pdgfra)
   04014 Ras signaling pathway
    110295292 (Pdgfra)
   04015 Rap1 signaling pathway
    110295292 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110295292 (Pdgfra)
   04020 Calcium signaling pathway
    110295292 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110295292 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110295292 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110295292 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295292 (Pdgfra)
   04540 Gap junction
    110295292 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295292 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295292 (Pdgfra)
   05206 MicroRNAs in cancer
    110295292 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110295292 (Pdgfra)
   05231 Choline metabolism in cancer
    110295292 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110295292 (Pdgfra)
   05218 Melanoma
    110295292 (Pdgfra)
   05215 Prostate cancer
    110295292 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110295292 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295292 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295292 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110295292 (Pdgfra)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110295292 (Pdgfra)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110295292 (Pdgfra)
CD molecules [BR:mcal04090]
 Proteins
  110295292 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set ig Ig_2 Pkinase V-set Herpes_gE C2-set_2 C1-set
Other DBs
NCBI-GeneID: 110295292
NCBI-ProteinID: XP_021019454
Ensembl: MGP_CAROLIEiJ_G0027309
UniProt: A0A6P7QY64
LinkDB
Position
5
AA seq 790 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAVIPCRTTDPETQVTLHKNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPDIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVYFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVVVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLGKSARA
HSGKYDLSVV
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaatgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaaatgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggtcaacgcctctgccgcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgacagattctttagtcatcgtg
gaggaggatgattctgctgtcataccttgccgcaccacagatccggaaactcaagtaacc
ttgcacaagaacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacggg
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaacgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaactatcgtggtgacctgtgctgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccgtccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgcgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagatcgagcccacc
tttggccagctggaagctgtcaacttgcatgaagtcagagagttcgtggtggaggtgcag
gcctacccgacacccaggatatcatggctgaaggacaacttgactctgatagagaatctc
accgagatcaccaccgacgtacagaagagtcaggaaacaaggtatcaaagcaaattaaag
ctgattcgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattctggacctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgcacagccgaaggcacc
cctcttccggacatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcgaatattatcacagagctccctcgccgcggc
aggagtaccgtggagggacgagtgtacttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccacc
ctgcgatctgaactcacagtggcggccgcagtgctggtgctgttggtggttgtcattgtg
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttatgactccagatgggaattcccgagagatggcctcgtgcttggtcggatcttggga
tccggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagcgaaaagcaggct
ctcatgtccgagctgaagataatgactcacctggggccgcatttgaatattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttacataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataatggcgactacatggacatgaagcaagctgataccaca
caatatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctaggtaaaagcgcccgtgct
cattctggcaaatatgatctttctgtggtttaa

KEGG   Mus caroli (Ryukyu mouse): 110295947
Entry
110295947         CDS       T05910                                 

Gene name
Met
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal05100  Bacterial invasion of epithelial cells
mcal05144  Malaria
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05218  Melanoma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295947 (Met)
   04014 Ras signaling pathway
    110295947 (Met)
   04015 Rap1 signaling pathway
    110295947 (Met)
   04020 Calcium signaling pathway
    110295947 (Met)
   04151 PI3K-Akt signaling pathway
    110295947 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295947 (Met)
   04520 Adherens junction
    110295947 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110295947 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295947 (Met)
   05202 Transcriptional misregulation in cancer
    110295947 (Met)
   05206 MicroRNAs in cancer
    110295947 (Met)
   05205 Proteoglycans in cancer
    110295947 (Met)
   05230 Central carbon metabolism in cancer
    110295947 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110295947 (Met)
   05226 Gastric cancer
    110295947 (Met)
   05218 Melanoma
    110295947 (Met)
   05211 Renal cell carcinoma
    110295947 (Met)
   05223 Non-small cell lung cancer
    110295947 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110295947 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    110295947 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295947 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295947 (Met)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110295947 (Met)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  MET family
   110295947 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like SKG6
Other DBs
NCBI-GeneID: 110295947
NCBI-ProteinID: XP_021020024
Ensembl: MGP_CAROLIEiJ_G0028118
UniProt: A0A6P5PW78
LinkDB
Position
6
AA seq 1379 aa
MKAPTVLAPGILVLLLTLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCQDCSSKANSSGGVWKDNINMAL
LVDTYYDDQLISCGSVNRGTCRRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESNHFIYFLTVQKETLDAQSFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILYGVFAQSKPDSAEPVNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNFLL
DSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRSDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTISDEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLDSVSLPKLVIAVHE
VGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISMGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgaccttggtgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
tatcagctccccaacttcacggcagaaacccccatccagaatgtcgtcctacacggccat
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatctgaattcaagaccgggcccgtgttggaacacccagattgtttaccttgtcaggac
tgcagcagcaaagccaattcatcaggaggggtttggaaagacaacatcaacatggctctg
cttgttgacacatactatgatgatcaactcattagctgtggcagtgtcaacagagggacc
tgccggcggcatgtccttcctcctgacaattctgctgacatacagtccgaggttcactgc
atgttctccccagaagaagagtcagggcagtgtcctgactgtgtagtgagtgcccttgga
gccaaagtcctcctatcagaaaaggaccgcttcatcaatttctttgtggggaatacgatc
aattcctcctatcctcctggttattcactgcattcaatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgaccgaccagtcctatattgatgtcttaccagaattc
caagattcctatcccataaagtacatacatgccttcgaaagcaaccattttatttacttt
ctgactgtccaaaaggaaactctagatgctcagagttttcatacaagaataatcaggttc
tgttccgtagactctggattgcactcctacatggaaatgcccctggaatgcattctgaca
gaaaaaagaagaaagagatccacaagggaagaagtgtttaacatcctccaagctgcttat
gtcagtaaaccaggggccaatcttgctaagcaaataggagctagcccttctgatgacatt
ctctacggggtgtttgcacaaagcaagccagattctgctgaacctgtgaatcgatcagca
gtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aatgtgagatgtctccagcatttttacggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttcgggctgtgaggcgcgcagtgacgagtatcggacagagttcacc
acggctttgcagcgcgtcgacttattcatgggccggctcaaccaagtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtggtgctctctcggacggcacacttcactcctcatgtgaacttcctcctc
gattcccatcctgtatctccagaagtgattgttgagcatccatcaaatcaaaacggctat
acattggttgtcacaggaaagaagatcaccaagattccattgaatggcctgggctgtgga
catttccaatcctgcagtcagtgtctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttctgatgaatgccccagtggtacatggactcaagagatttgt
ctgccagcagtttataaggtgttccccaccagtgcaccccttgaaggaggaacagtgttg
accatatgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaatgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccgcgatgagtgagcacttcaatgtgtctgtaattatctca
aacagtcgagagacaacgcaatacagtgcattctcctatgtagatcctgtaataacaagc
atttctccgaggtacggccctcaggctggaggcaccttactcactcttactgggaaatac
ctcaacagtggcaattctagacacatttcaattggagggaaaacatgtactttaaaaagt
gtatcagatagtattcttgaatgctacaccccagcccaaactatctctgatgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctggactcggttagcctcccaaagctggtaatagctgtgcatgaa
gtgggcgtgaactacacagtggcatgtcagcatcgctcaaattcagagatcatctgctgc
actactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggattctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccactggcactctggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgttcttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcggtctcaata
tcagtagtagttttgttattatccgggctcttcctgtggatgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgccagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactacagagatggtttcaaatgagtctgtagac
tacagagctacttttccagaagaccagtttcccaactcctctcagaatggagcatgcaga
caagtgcaatatcctctgacagacctgtcccctatcctgacgagtggagactctgatata
tccagcccattactacaaaacactgttcacattgacctcagtgccctaaatccagagctg
gtccaagcagttcagcatgtagtgattggacccagcagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgctggacaatgacgga
aagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaatcatcatgaaagacttcagccatcccaatgttctctcactc
ttgggaatctgcctgcggagtgaagggtctcctctagtggtcctgccctatatgaaacat
ggagatcttcgaaatttcattcgaaacgagactcataatccaactgtgaaagatcttata
ggatttggccttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agagacttagctgcaagaaattgcatgttggatgaaaaattcactgtcaaggttgctgat
ttcggtcttgccagagacatgtatgataaagagtactatagtgtccacaacaagacgggt
gccaagctaccagtcaagtggatggctttagagagtctgcaaacacagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacgagaggagcccct
ccttaccccgacgtgaacacatttgatatcactatctacctgctgcaaggcagaagactc
ttgcagccagaatactgtccagatgccttgtacgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccatccttttctgaactggtctccaggatatcctcaatcttctcc
acgttcattggggaacactacgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgatggcgaggggaacacatga

KEGG   Mus caroli (Ryukyu mouse): 110297825
Entry
110297825         CDS       T05910                                 

Gene name
Igf1r
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04144  Endocytosis
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04730  Long-term depression
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297825 (Igf1r)
   04014 Ras signaling pathway
    110297825 (Igf1r)
   04015 Rap1 signaling pathway
    110297825 (Igf1r)
   04066 HIF-1 signaling pathway
    110297825 (Igf1r)
   04068 FoxO signaling pathway
    110297825 (Igf1r)
   04151 PI3K-Akt signaling pathway
    110297825 (Igf1r)
   04152 AMPK signaling pathway
    110297825 (Igf1r)
   04150 mTOR signaling pathway
    110297825 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110297825 (Igf1r)
   04140 Autophagy - animal
    110297825 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110297825 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297825 (Igf1r)
   04520 Adherens junction
    110297825 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    110297825 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110297825 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    110297825 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    110297825 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    110297825 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    110297825 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297825 (Igf1r)
   05202 Transcriptional misregulation in cancer
    110297825 (Igf1r)
   05205 Proteoglycans in cancer
    110297825 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110297825 (Igf1r)
   05214 Glioma
    110297825 (Igf1r)
   05218 Melanoma
    110297825 (Igf1r)
   05215 Prostate cancer
    110297825 (Igf1r)
   05224 Breast cancer
    110297825 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297825 (Igf1r)
   01522 Endocrine resistance
    110297825 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297825 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110297825 (Igf1r)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110297825 (Igf1r)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   110297825 (Igf1r)
CD molecules [BR:mcal04090]
 Proteins
  110297825 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 110297825
NCBI-ProteinID: XP_021022505
Ensembl: MGP_CAROLIEiJ_G0029853
UniProt: A0A6P5Q006
LinkDB
Position
7
AA seq 1373 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELEMEPENMESVPLDPSASSASL
PLPERHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4122 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacattcgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgagtggctggccttgagagcctgggagacctcttc
cccaacctcacagtcatccggggctggaaactcttctacaactacgccttggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattacccggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccaaaggaatgtggggac
ctgtgtccagggacattggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgttgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggatgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgt
gtgcccgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggaccgcgat
ttctgcgccaacatccccaacgctgagagcagtgactcggatggcttcgttatccacgac
gatgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgtgaaggcccctgccccaaagtctgcggcgatgaagagaagaaaacgaaa
accatcgattcggtgacttctgctcaaatgctccaaggatgcaccatcttgaagggcaat
ctgcttattaacatccggcgaggcaataacattgcctcggagctggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaacctccgtctcatcttaggagaggagcagctggaagggaactactcc
ttctatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtcggggaagatgtactttgctttcaatcccaagctgtgtgtctctgaaatt
taccgcatggaggaagtgaccggaaccaagggacgccagagcaaaggggacataaatacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctctaccacg
acctggaagaaccgaatcatcattacgtggcaccggtaccggccgccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccctttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtagacctgcctccgaac
aaggagggcgagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccacatccgtggggccaaaagt
gaaatcttgtacattcgcaccaatgcttcagtcccttccattcccctagatgtcctctcg
gcatcaaactcttcctctcagctgattgtgaagtggaatcccccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctctaaagacaaaatacccatcagaaagtacgccgatggtaccatcgac
gtggaggaggtgacggaaaatcccaagacagaagtgtgtggtggtgataaagggccatgc
tgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggccgagtaccgt
aaagtctttgagaatttccttcacaattccatctttgtgcccaggcccgaaaggaggcgg
agagacgtcatgcaagtggccaacacgaccatgtccagccgaagcaggaacaccacagta
gctgacacctacaatatcacagacccggaggagttcgagacagagtaccctttctttgag
agcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactctgtac
cgaatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagtgcctccaac
ttcgtctttgcaagaaccatgccagcagaaggagctgatgatatccctggcccggtgacc
tgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaaccccaat
ggattgatcctaatgtatgaaattaaatacgggtcacaagttgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtacggaggggccaaacttaaccgtctaaacccaggg
aactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagatcct
gtgttcttctatgtcccggccaaaacgacgtatgaaaacttcatgcatctgatcattgct
ctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttccat
agaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaagatc
accatgaaccgggagctcggacaagggtcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtgaacgaggctgca
agtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaggaattcaattgt
caccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgtggcgatctcaaaagttatctccggtctctaaggccagaagtggag
cagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctggagag
atcgcagatggcatggcctacctcaatgccaacaagttcgtccacagagaccttgctgct
aggaactgcatggtagccgaagatttcacggtcaaaattggagattttggtatgacacga
gacatctacgagacggactactaccggaaaggtgggaaagggttgctgcctgtgcgctgg
atgtctcccgagtccctcaaggatggcgtcttcactactcattctgatgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggctgagcagccctaccagggcttgtccaac
gagcaagttcttcgtttcgtcatggagggcggccttctggacaagccggacaactgcccc
gatatgctgtttgaacttatgcgcatgtgctggcagtataaccccaagatgcggccctcc
ttcctggagatcatcggcagcatcaaggatgaaatggagcccagcttccaggaggtctcc
ttctactacagcgaggagaacaagcctcccgagccggaagagctggagatggagctggag
atggagcccgagaacatggagagcgtcccactggacccctcagcctcctcagcctccctg
cctctgcctgaaagacactcaggacacaaggctgagaatggcccgggccctggtgtgctg
gttcttcgtgccagttttgatgagagacagccttacgctcacatgaacgggggacgtgcc
aacgagagggccttgcctctgccccagtcctcgacctgctga

KEGG   Mus caroli (Ryukyu mouse): 110299550
Entry
110299550         CDS       T05910                                 

Gene name
Fgfr1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04714  Thermogenesis
mcal04810  Regulation of actin cytoskeleton
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299550 (Fgfr1)
   04014 Ras signaling pathway
    110299550 (Fgfr1)
   04015 Rap1 signaling pathway
    110299550 (Fgfr1)
   04020 Calcium signaling pathway
    110299550 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    110299550 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110299550 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110299550 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299550 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110299550 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110299550 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299550 (Fgfr1)
   05205 Proteoglycans in cancer
    110299550 (Fgfr1)
   05230 Central carbon metabolism in cancer
    110299550 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    110299550 (Fgfr1)
   05215 Prostate cancer
    110299550 (Fgfr1)
   05224 Breast cancer
    110299550 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110299550 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110299550 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299550 (Fgfr1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110299550 (Fgfr1)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   110299550 (Fgfr1)
CD molecules [BR:mcal04090]
 Proteins
  110299550 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299550 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 110299550
NCBI-ProteinID: XP_021024914
Ensembl: MGP_CAROLIEiJ_G0030923
UniProt: A0A6P5Q569
LinkDB
Position
8
AA seq 820 aa
MWGWKCLLFWAVLVTAALCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggggctggaagtgcctgctcttctgggctgtgctggtcacagccgctctctgcact
gccaggccagccccaaccttgcccgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccctgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcgtcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcacgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagttcaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgatgttgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagccgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgtatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtgtcagctgactccagtgcatccatgaactctggggttctc
ctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtctcggaa
tatgagctccccgaggatccccgctgggagctgccacgagacagactggtcttaggcaaa
ccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctggataaa
gacaaacccaaccgcgtgaccaaagtggccgtgaagatgttgaagtccgacgcaacggag
aaggacctgtcagatctgatctcggagatggagatgatgaaaatgatcgggaagcacaag
aatatcatcaaccttctgggggcatgcacacaggatggtcctctttatgtcattgtggag
tatgcctccaaaggcaatctccgggagtatctacaggcccggaggcctccggggctggag
tactgctacaaccccagccacaaccccgaggaacagctgtcttccaaagatctggtatcc
tgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtatacaccga
gacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgcagacttt
ggcttagctcgagacattcaccatatcgactactacaagaaaaccaccaacggccggctg
cctgtgaagtggatggcccctgaggcattgtttgaccggatctacacccaccagagcgat
gtgtggtcttttggagtgctcctgtgggagatcttcactctgggtggctccccatatcct
ggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggacaagccc
agtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtgccctct
cagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttgacctcc
aaccaggagtatctggacctgtccataccgctggaccagtactcacccagctttcccgac
acacggagctccacctgctcctcaggggaggactctgtcttctctcatgagcctttacct
gaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaacggcgc
tga

KEGG   Mus caroli (Ryukyu mouse): 110304228
Entry
110304228         CDS       T05910                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304228 (Egfr)
   04012 ErbB signaling pathway
    110304228 (Egfr)
   04014 Ras signaling pathway
    110304228 (Egfr)
   04015 Rap1 signaling pathway
    110304228 (Egfr)
   04630 JAK-STAT signaling pathway
    110304228 (Egfr)
   04066 HIF-1 signaling pathway
    110304228 (Egfr)
   04068 FoxO signaling pathway
    110304228 (Egfr)
   04020 Calcium signaling pathway
    110304228 (Egfr)
   04072 Phospholipase D signaling pathway
    110304228 (Egfr)
   04151 PI3K-Akt signaling pathway
    110304228 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110304228 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304228 (Egfr)
   04520 Adherens junction
    110304228 (Egfr)
   04540 Gap junction
    110304228 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110304228 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110304228 (Egfr)
   04915 Estrogen signaling pathway
    110304228 (Egfr)
   04921 Oxytocin signaling pathway
    110304228 (Egfr)
   04926 Relaxin signaling pathway
    110304228 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    110304228 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304228 (Egfr)
   05206 MicroRNAs in cancer
    110304228 (Egfr)
   05205 Proteoglycans in cancer
    110304228 (Egfr)
   05230 Central carbon metabolism in cancer
    110304228 (Egfr)
   05231 Choline metabolism in cancer
    110304228 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110304228 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304228 (Egfr)
   05212 Pancreatic cancer
    110304228 (Egfr)
   05225 Hepatocellular carcinoma
    110304228 (Egfr)
   05226 Gastric cancer
    110304228 (Egfr)
   05214 Glioma
    110304228 (Egfr)
   05218 Melanoma
    110304228 (Egfr)
   05219 Bladder cancer
    110304228 (Egfr)
   05215 Prostate cancer
    110304228 (Egfr)
   05213 Endometrial cancer
    110304228 (Egfr)
   05224 Breast cancer
    110304228 (Egfr)
   05223 Non-small cell lung cancer
    110304228 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304228 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110304228 (Egfr)
   05171 Coronavirus disease - COVID-19
    110304228 (Egfr)
   05163 Human cytomegalovirus infection
    110304228 (Egfr)
   05165 Human papillomavirus infection
    110304228 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304228 (Egfr)
   01522 Endocrine resistance
    110304228 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304228 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304228 (Egfr)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110304228 (Egfr)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110304228 (Egfr)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110304228 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   110304228 (Egfr)
  Exosomal proteins of bladder cancer cells
   110304228 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 110304228
NCBI-ProteinID: XP_021031116
Ensembl: MGP_CAROLIEiJ_G0016103
UniProt: A0A6P5QM34
LinkDB
Position
11
AA seq 1210 aa
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQKNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDSIQWRDIVQNVFLSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIVSGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAMNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDTFLQRYSSDPTGVVTED
NIDDAFLPVPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgctgctgaccgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaagaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggac
tctatccagtggagggacatcgtccaaaacgtctttctgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgttgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgccgcggggtgt
acgggtccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacgtgtgtgaagaagtgcccccgaaactatgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactatgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacattctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctggacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcctggcctgaaaactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtt
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcgtttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccatgaaccacgtctgcaatcctttatgctcctcagaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgtcatcca
gaatgtctaccccaaaccatgaacatcacctgtacaggcagggggccagacaactgcatc
cagtgtgcccactacattgatggcccacattgtgtcaagacctgcccagctggcatcatg
ggggagaacaacactctagtctggaagtatgcagatgccaataatgtctgccacctatgc
catgccaactgtacctatggatgtgctgggccaggccttcaaggatgtgaagtatggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttggaatcggcctattcatgcgaaggcgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggcgagaaagta
aaaatcccagtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactatgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgcagaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacacagaatttatacacaccaaagcgatgtctgg
agctatggtgtcaccgtgtgggaactgatgacctttgggtccaagccttatgatggaata
ccagcaagtgacatctcatccatcctagagaaaggagaacgccttccacagccacctatc
tgcaccattgatgtctacatgatcatggtcaagtgctggatgatagatgctgacagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacaacgctac
cttgttatccagggggatgaaagaatgcacttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacatccaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacaccttcttgcagcggtacagctccgaccccacaggtgttgtaacagaggac
aacatagatgatgcattcctccctgtacctgaatatataaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgccgtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagccaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatctttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

DBGET integrated database retrieval system