KEGG   Mus caroli (Ryukyu mouse): 110284933
Entry
110284933         CDS       T05910                                 

Gene name
Smad4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04659  Th17 cell differentiation
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110284933 (Smad4)
   04350 TGF-beta signaling pathway
    110284933 (Smad4)
   04390 Hippo signaling pathway
    110284933 (Smad4)
   04371 Apelin signaling pathway
    110284933 (Smad4)
   04068 FoxO signaling pathway
    110284933 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110284933 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110284933 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    110284933 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110284933 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110284933 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110284933 (Smad4)
   05212 Pancreatic cancer
    110284933 (Smad4)
   05225 Hepatocellular carcinoma
    110284933 (Smad4)
   05226 Gastric cancer
    110284933 (Smad4)
   05220 Chronic myeloid leukemia
    110284933 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110284933 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110284933 (Smad4)
   05161 Hepatitis B
    110284933 (Smad4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 110284933
NCBI-ProteinID: XP_021006599
Ensembl: MGP_CAROLIEiJ_G0022392
UniProt: A0A6P5P2Q8
LinkDB
Position
18
AA seq 551 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQT
IQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIA
SGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDR
FCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRA
PGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPA
ISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLH
TMPIADPQPLD
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacaatatgtctataacaaacacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgtcacagacagggcggggagagtgaaacgtttgcaaaaagagcgatt
gagagtttggtaaagaagctgaaggagaaaaaagatgagctggactctttaataacagct
ataactaccaacggcgctcatcccagcaaatgtgtcaccatacagaggacattggacgga
cggctgcaggtggctggtcggaaaggattccctcatgtgatctacgcccgtctgtggagg
tggcctgatctacacaagaatgaactgaagcatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgacagtgtctgtgtgaatccatatcactatgagcgggttgtctcccctgga
attgatctctcaggattaacactgcagagtaatgctccaagtatgttagtgaaggatgag
tacgttcatgactttgaaggacagccgtccttacccactgaaggacattcgattcaaacc
atccaacacccgccaagtaatcgggcatcaacggagacatacagcgccccggctctgtta
gccccggcagagtctaacgccaccagcaccaccaacttccccaacattcctgtggcttcc
acaagtcagccggccagtattctggcgggcagccatagtgaaggactgttgcagatagct
tcagggcctcagccaggacagcagcagaatggatttactgctcagccagctacttaccat
cataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttgcct
caccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcctggacattac
tggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcctgag
tactggtgttccattgcttactttgaaatggatgttcaggtaggagagacgtttaaggtc
ccttcaagctgccctgttgtgactgtggatggctatgtggatccttcaggaggagatcgc
ttttgcttgggtcaactctccaatgtccacaggacagaagcgattgagagagcgaggttg
cacataggcaaaggagtgcagttggaatgtaaaggtgaaggtgacgtttgggtcaggtgc
cttagtgaccacgcggtctttgtacagagttactacctggacagagaagctggccgagca
cctggcgacgctgttcataagatctacccaagcgcgtatataaaggtctttgatctgcgg
cagtgtcaccggcagatgcagcaacaggcggccactgcgcaagctgcagctgctgctcag
gcggcggccgtggcagggaacatccctggccctgggtccgtgggtggaatagccccagcc
atcagtctgtctgctgctgctggcatcggtgtggatgacctccggcgcttgtgcattctc
aggatgagctttgtgaagggctggggcccagactacccgaggcagagcatcaaggaaacc
ccgtgctggattgagattcacctccaccgagctctgcagctcttggatgaagtcctgcac
accatgcccattgcggacccacagcctttagactga

DBGET integrated database retrieval system