KEGG   Mus caroli (Ryukyu mouse): 110284988
Entry
110284988         CDS       T05910                                 

Gene name
Bmi1
Definition
(RefSeq) polycomb complex protein BMI-1
  KO
K11459  polycomb group RING finger protein 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110284988 (Bmi1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110284988 (Bmi1)
   05206 MicroRNAs in cancer
    110284988 (Bmi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110284988 (Bmi1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     110284988 (Bmi1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 110284988
NCBI-ProteinID: XP_021006661
Ensembl: MGP_CAROLIEiJ_G0023207
UniProt: A0A6P5NU54
LinkDB
Position
2
AA seq 324 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
EKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSK
MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDG
LTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSG
NHQSSFASRPRKSSINGSSATSSG
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacttaatgtgtgtcctg
tgtggagggtacttcattgatgccactaccataatagaatgtctacattccttctgtaaa
acatgtattgtgcgttacttggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaaaactagaccactcctgaacataaggtcagataaaactcttcaagatattgtatac
aaattagttccagggcttttcaaaaatgagatgaagagaagaagagatttttatgcagct
cacccttcagctgatgctgccaatggctccaacgaagacagaggagaagttgcagatgag
gagaagcggattataactgatgatgagataataagcttgtctattgagttctttgatcag
agccgattggatcggaaagtaaataaagagaagcccaaggaagaggtgaatgataaaagg
tacttacgatgcccagcagcaatgactgtgatgcacttgagaaagtttctcaggagtaaa
atggacatacctaatactttccagattgacgtcatgtatgaagaggaacctttaaaggat
tattacacactaatggacattgcctacatttatacctggagaagaaatggcccactacct
ttgaaatacagagttcggccaacttgcaaaagaatgaagatgagtcaccagagggatgga
ctgacgaatgctggagagctggaaagtgactctgggagtgacaaggccaacagcccagca
ggaggtgttccctccacctcttcctgtttgcccagtcccagcactccagtgcagtctcct
cacccacagttccctcacatttccagtaccatgaatggaaccagcaacagccccagtggt
aaccaccaatcttcctttgccagtagacctcgaaaatcatcaataaatgggtcatcagca
acttcatctggttag

DBGET integrated database retrieval system