KEGG   Mus caroli (Ryukyu mouse): 110285029
Entry
110285029         CDS       T05910                                 

Gene name
Pmaip1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1 isoform X1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110285029 (Pmaip1)
   04215 Apoptosis - multiple species
    110285029 (Pmaip1)
   04115 p53 signaling pathway
    110285029 (Pmaip1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285029 (Pmaip1)
   05203 Viral carcinogenesis
    110285029 (Pmaip1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110285029 (Pmaip1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110285029 (Pmaip1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 110285029
NCBI-ProteinID: XP_021006722
Ensembl: MGP_CAROLIEiJ_G0022361
UniProt: A0A6P5NX39
LinkDB
Position
18
AA seq 103 aa
MPGRKARRNAPVNPTRAELPPELVAQLRKIGDKVYCTWSAPDITVLLAQMPGKSQKSRMR
SPSPTGVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcccgggagaaaggcgcgtcggaacgcgccagtgaacccaacgcgggcagagctaccg
cctgagttagtagctcaactcaggaagattggagacaaagtgtattgcacgtggagtgca
ccggacataactgtgcttctggcgcagatgcctgggaagtcgcaaaagagcaggatgagg
agcccaagcccaaccggggtgccagcagacttgaaggacgagtgtgctcaactccggaga
attggggacaaagtgaatttacggcagaaacttctgaatttgatttccaagctcttcaat
ttagtaacctga

DBGET integrated database retrieval system