KEGG   Mus caroli (Ryukyu mouse): 110285093
Entry
110285093         CDS       T05910                                 

Gene name
Wnt8a
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110285093 (Wnt8a)
   04390 Hippo signaling pathway
    110285093 (Wnt8a)
   04150 mTOR signaling pathway
    110285093 (Wnt8a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110285093 (Wnt8a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110285093 (Wnt8a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285093 (Wnt8a)
   05205 Proteoglycans in cancer
    110285093 (Wnt8a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285093 (Wnt8a)
   05226 Gastric cancer
    110285093 (Wnt8a)
   05217 Basal cell carcinoma
    110285093 (Wnt8a)
   05224 Breast cancer
    110285093 (Wnt8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285093 (Wnt8a)
   05022 Pathways of neurodegeneration - multiple diseases
    110285093 (Wnt8a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110285093 (Wnt8a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110285093 (Wnt8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110285093 (Wnt8a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110285093 (Wnt8a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110285093
NCBI-ProteinID: XP_021006766
Ensembl: MGP_CAROLIEiJ_G0022090
UniProt: A0A6P5NUD6
LinkDB
Position
18
AA seq 354 aa
MGHLLMLWVAAGMCYPALGASAWSVNNFLVTGPKAYLTYTASVALGAQIGMEECKFQFAW
ERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNG
KTGGHGWIWGGCSDNVEFGEKISRLFVDGLEKGKDARALVNLHNNRAGRLAVRASTKRTC
KCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEA
FLPSTEAELIFLEGSPDYCNRNASLSIHGTEGRECLQNARSASRREQRSCGRLCTECGLQ
VEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPAGSARPRGRGKDSAW
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggacacttgttaatgctgtgggtggctgcgggcatgtgctatccagccctgggtgct
tctgcctggtcagtgaacaacttcctggtaacgggtcccaaggcctatctgacctacacc
gccagtgtggccttgggagctcagattggcatggaagagtgtaagttccagtttgcctgg
gaacggtggaattgtcctgagcatgcctttcagttttcaacccacaacaggctgcgagct
gccacgagagagacatccttcattcatgccatccgctctgctgccatcatgtatgcagtc
accaagaactgcagcatgggtgacttggaaaactgcggctgtgacgagtcacaaaatgga
aaaacaggtggccatggctggatctggggaggctgcagtgacaatgtggaattcggggaa
aaaatctccagactcttcgtggacggtttggagaaagggaaggatgccagagccctggtg
aaccttcacaacaacagggccggcaggctggcagtgagggcctccacgaaaaggacctgc
aagtgtcatggcatctcaggaagctgcagcatccagacgtgttggctgcagctggctgac
ttccggcagatgggaaattacctaaaggccaagtatgaccgcgcactgaaaattgagatg
gataagcgccagctaagggctggcaacagagccgagggccgctgggctctcacggaggcc
ttccttcccagcacagaggctgagctgatcttcttagagggttctcctgactactgcaac
cgcaacgccagcctgagcatccacggcacagaggggagggagtgcctgcagaatgcccgc
agtgcttcccggcgggagcagcgcagctgtgggcgcctgtgcacggagtgcgggctgcag
gtggaggagaggagagcagaggccgtgagcagctgtgactgcaactttcagtggtgttgc
actgtcaagtgtggccagtgcaggcgtgtggtgagcagatactactgcacacgccctgca
ggtagtgccaggccccggggcaggggcaaggacagtgcctggtaa

KEGG   Mus caroli (Ryukyu mouse): 110285759
Entry
110285759         CDS       T05910                                 

Gene name
Wnt8b
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110285759 (Wnt8b)
   04390 Hippo signaling pathway
    110285759 (Wnt8b)
   04150 mTOR signaling pathway
    110285759 (Wnt8b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110285759 (Wnt8b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110285759 (Wnt8b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285759 (Wnt8b)
   05205 Proteoglycans in cancer
    110285759 (Wnt8b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285759 (Wnt8b)
   05226 Gastric cancer
    110285759 (Wnt8b)
   05217 Basal cell carcinoma
    110285759 (Wnt8b)
   05224 Breast cancer
    110285759 (Wnt8b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285759 (Wnt8b)
   05022 Pathways of neurodegeneration - multiple diseases
    110285759 (Wnt8b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110285759 (Wnt8b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110285759 (Wnt8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110285759 (Wnt8b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110285759 (Wnt8b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110285759
NCBI-ProteinID: XP_021007810
Ensembl: MGP_CAROLIEiJ_G0022999
LinkDB
Position
19
AA seq 368 aa
MLPISQCLSRSPCVSPKTMFLMKPVCVLLVTCVLHRSHAWSVNNFLMTGPKAYLVYSSSV
AAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRN
CSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLH
NNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG
AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE
RRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPLRGA
AHKPGKNP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcttcccatctctcaatgtttaagtcgctctccctgcgtttctccgaagaccatgttt
cttatgaagcctgtgtgcgttcttctagtcacttgtgtccttcaccgcagccacgcctgg
tcagtgaacaattttctgatgaccggtccaaaggcttacctggtctactccagcagcgtg
gccgctggcgcccagagtggtattgaagagtgtaaataccagtttgcttgggaccgttgg
aattgccccgagagagctttacagctgtccagccatggtggacttcggagcgctaaccgg
gagacagcatttgtgcacgccatcagctctgctggggttatgtacaccctgactagaaac
tgcagcctcggagactttgacaactgtggctgtgatgactcccgaaatggacaactgggg
ggccaaggttggctctggggaggctgcagtgacaacgtgggcttcggagaggcaatttcc
aagcagtttgtggatgccctcgagacaggacaagatgcccgggcagccatgaatctgcac
aacaatgaggctggccgcaaggcggtcaagggcactatgaaacgcacgtgtaagtgccac
ggtgtgtccggcagctgcaccacgcagacttgctggttgcaactgccagagttccgggag
gtaggcgcgcacttgaaggagaagtatcacgcggcgctcaaggtggacctgctgcagggc
gcgggcaacagcgcggcgggccgcggcgccatcgccgacaccttccgctccatctccaca
cgcgagctggtgcatctggaggactccccagactactgcctggaaaacaagaccctgggg
ctgctaggcaccgagggccgagagtgtctgcggcgcgggcgcgccctgggtcgctgggag
cgccgcagttgtcgccgactgtgcggggactgcgggctagcggtggaggagcgccgcgcc
gagacagtgtccagctgcaactgcaagtttcactggtgctgcgcggtccgctgcgagcag
tgccgccggcgggtcaccaagtacttctgcagccgcgcagagcggccgctcagaggcgct
gcgcacaaacccgggaagaacccctaa

KEGG   Mus caroli (Ryukyu mouse): 110291476
Entry
110291476         CDS       T05910                                 

Gene name
Wnt2b
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110291476 (Wnt2b)
   04390 Hippo signaling pathway
    110291476 (Wnt2b)
   04150 mTOR signaling pathway
    110291476 (Wnt2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110291476 (Wnt2b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110291476 (Wnt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291476 (Wnt2b)
   05205 Proteoglycans in cancer
    110291476 (Wnt2b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110291476 (Wnt2b)
   05226 Gastric cancer
    110291476 (Wnt2b)
   05217 Basal cell carcinoma
    110291476 (Wnt2b)
   05224 Breast cancer
    110291476 (Wnt2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110291476 (Wnt2b)
   05022 Pathways of neurodegeneration - multiple diseases
    110291476 (Wnt2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110291476 (Wnt2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110291476 (Wnt2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110291476 (Wnt2b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110291476 (Wnt2b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110291476
NCBI-ProteinID: XP_021014309
Ensembl: MGP_CAROLIEiJ_G0025470
UniProt: A0A6P5PH38
LinkDB
Position
3
AA seq 389 aa
MLKLQGEDEAAQLAPRRARVPVPRPTAPDVSPSSARLGLACLLLLLLLTLPARVDTSWWY
IGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLD
RDHTVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGD
FDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGV
SGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLVYF
DNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWC
CAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctgaagctgcagggtgaggacgaagccgcgcagctcgcccctcggcgtgcccgcgtc
cccgtgcccagacccacggcccccgacgtgtccccatcttccgcccgcctgggtcttgcc
tgcctgctgctgctgctactcctgactctcccagcccgtgtagacacgtcctggtggtac
ataggggcactgggagcccgagtgatctgtgacaacatccccggtctggtgagccggcag
cggcagttgtgtcagcgctacccagacatcatgcgctcagtaggtgaaggtgcccgggaa
tggatccgagagtgtcagcaccagttccgtcatcaccgctggaattgcaccacactggac
cgggaccacactgtctttggccgtgccatgctcagaagcagccgggaggcagcgttcgtc
tatgctatctcatcggcaggagtggtccacgctatcactcgggcctgcagccagggtgag
ctgagcgtgtgcagctgtgacccatatacccgcggtcggcaccatgatcaacgaggggac
tttgactggggtggctgtagtgacaacatccactacggtgttcgctttgccaaggctttt
gtggatgccaaagagaagaggcttaaggacgcccgggccctcatgaacttacacaacaac
cgctgtggtcgcacggctgttcggagattcctgaagctggagtgcaagtgtcatggtgtg
agtggctcctgtactctgcgtacctgctggagggcactctcagacttccgacgcacaggt
gactacctgaggaggcgatatgatggggctgtgcaggtgacggccacacaggatggggcc
aatttcacagcagcgcgccagggctatcgccatgccaccaggactgatcttgtctacttt
gacaactcccctgactactgtgtcttggacaaggctgcaggttccctaggtaccgcaggc
cgcgtctgcagcaagacttctaaaggaacagatgggtgtgaaatcatgtgttgcggccga
gggtatgacacaactcgggtcacccgcgtcacccagtgtgagtgcaaattccactggtgc
tgtgctgtgcggtgcaaggagtgcagaaacactgtggatgttcacacgtgcaaggccccg
aagaaggcagagtggctggaccagacctga

KEGG   Mus caroli (Ryukyu mouse): 110293218
Entry
110293218         CDS       T05910                                 

Gene name
Wnt4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04919  Thyroid hormone signaling pathway
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110293218 (Wnt4)
   04390 Hippo signaling pathway
    110293218 (Wnt4)
   04150 mTOR signaling pathway
    110293218 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110293218 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110293218 (Wnt4)
   04916 Melanogenesis
    110293218 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    110293218 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293218 (Wnt4)
   05205 Proteoglycans in cancer
    110293218 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110293218 (Wnt4)
   05226 Gastric cancer
    110293218 (Wnt4)
   05217 Basal cell carcinoma
    110293218 (Wnt4)
   05224 Breast cancer
    110293218 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110293218 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    110293218 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110293218 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110293218 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110293218 (Wnt4)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110293218 (Wnt4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 110293218
NCBI-ProteinID: XP_021016732
Ensembl: MGP_CAROLIEiJ_G0026673
UniProt: A0A6P5PNT9
LinkDB
Position
4
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccccgttcgtgtctgcggtccctgcgacttctcgtcttcgccgtgttctcggcc
gccgcgagcaactggctgtacctggccaagctgtcatcggtgggcagcatctctgaagag
gagacgtgcgagaagctcaaaggtctgatccagaggcaggtgcagatgtgcaaacggaac
ctcgaggtgatggactcagtgcgccgtggcgcccagctggccatcgaggagtgccaatac
cagttccggaatcggcgctggaactgttccacactggactccctccctgtctttgggaag
gtggtgacacaagggacccgggaggcggcctttgtatacgccatctcttcagcaggtgtg
gcctttgcagtaacaagggcatgcagcagtggagagctggagaagtgtggctgtgaccgg
acagtgcacggggtcagcccacagggcttccagtggtcgggatgctcggacaacatcgcc
tatggcgtagccttctcacagtcctttgtggacgtccgggagaggagcaagggggcctcc
tccagccgggcactcatgaatcttcacaacaacgaggctggcaggaaggccatcttgaca
cacatgcgggtggagtgcaagtgtcatggggtgtcgggctcctgcgaggtaaagacgtgc
tggcgtgctgtaccgcccttccgccaggttggccacgcgctaaaggagaagtttgacggt
gccacggaggtggagccacggcgcgtgggctcctcccgggcgctggtgccccggaatgca
cagttcaagccacatacagatgaggacctggtatacctggagcctagtccggacttctgt
gagcaggacatgcgcagtggcgtgctaggcacgaggggccgcacgtgcaacaagacatct
aaagccattgacggctgcgagctactgtgctgtggccgcggcttccacacagcgcaggtg
gagctggccgagcgctgtggctgcaggttccactggtgctgcttcgtcaagtgccggcag
tgccagcgtctcgtggagatgcacacgtgccggtga

KEGG   Mus caroli (Ryukyu mouse): 110295760
Entry
110295760         CDS       T05910                                 

Gene name
Wnt5b
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110295760 (Wnt5b)
   04390 Hippo signaling pathway
    110295760 (Wnt5b)
   04150 mTOR signaling pathway
    110295760 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110295760 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110295760 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    110295760 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295760 (Wnt5b)
   05205 Proteoglycans in cancer
    110295760 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110295760 (Wnt5b)
   05226 Gastric cancer
    110295760 (Wnt5b)
   05217 Basal cell carcinoma
    110295760 (Wnt5b)
   05224 Breast cancer
    110295760 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295760 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    110295760 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295760 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110295760 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110295760 (Wnt5b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110295760 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110295760
NCBI-ProteinID: XP_021019811
LinkDB
Position
6
AA seq 300 aa
MAARCQEEAPLWKMLVPGHWDGLRPAMPSLLLVVVAALLSSWAQLLTDANSWWSLALNPV
QRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNC
STVDNTSVFGRVMQIGFSLVILILLLPQAVYKMADVACKCHGVSGSCSLKTCWLQLAEFR
KVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGT
QGRLCNKTSEGMDGCELMCCGRGYDRFKSXQVERCHCRFHWCCFVRCKKCTEVVDQYVCK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggcggctaggtgccaagaggaagctccactttggaagatgttggtcccagggcattgg
gatgggttgaggccagccatgcccagcctgctgctggtggtcgtggcagctctgctctcc
agctgggcacagctgctgactgacgccaactcctggtggtcactagctctgaacccggtg
cagagaccggagatgttcatcattggcgctcagccngtgtgcagtcaacttcctgggctt
tccccaggccagagaaagctgtgtcagttgtatcaggagcacatgtcctacatcggggag
ggagccaagacgggcatcagagagtgccagcaccagtttcgacagaggcgctggaactgc
agcaccgtggacaacacatctgtctttggcagagttatgcagataggattctccttagtt
attctcattcttctcctcccccaggccgtctataagatggctgatgtcgcctgcaaatgt
cacggagtctccgggtcctgcagcctcaagacctgctggcttcagctggccgagttccgc
aaggtgggggaccgtttgaaggagaagtacgacagcgccgcggccatgcgcatcacccgc
cagggcaagctngagctggccaacagccgcttcaaccagcccaccccagaggacctggtc
tacgtggaccccagtcctgactactgcctgcgtaatgagaccacaggctccctgggcacc
cagggtcgcctctgcaacaagacctcagagggcatggacggctgcgagctcatgtgctgt
ggccgcggctatgaccgcttcaagagcntccaggtggaacgctgccactgcaggtttcac
tggtgttgctttgtcagatgcaaaaaatgcaccgaggttgtggaccagtatgtctgtaag
tga

KEGG   Mus caroli (Ryukyu mouse): 110296313
Entry
110296313         CDS       T05910                                 

Gene name
Wnt2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110296313 (Wnt2)
   04390 Hippo signaling pathway
    110296313 (Wnt2)
   04150 mTOR signaling pathway
    110296313 (Wnt2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110296313 (Wnt2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110296313 (Wnt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296313 (Wnt2)
   05205 Proteoglycans in cancer
    110296313 (Wnt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110296313 (Wnt2)
   05226 Gastric cancer
    110296313 (Wnt2)
   05217 Basal cell carcinoma
    110296313 (Wnt2)
   05224 Breast cancer
    110296313 (Wnt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296313 (Wnt2)
   05022 Pathways of neurodegeneration - multiple diseases
    110296313 (Wnt2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110296313 (Wnt2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110296313 (Wnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110296313 (Wnt2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110296313 (Wnt2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110296313
NCBI-ProteinID: XP_021020616
Ensembl: MGP_CAROLIEiJ_G0028121
UniProt: A0A6P5PXI6
LinkDB
Position
6
AA seq 360 aa
MNVPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWATPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgtccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccggcagcgtcagctgtgccaccgacacccagat
gtgatgcgtgccattggcctgggtgtggctgagtggactgcagagtgccagcaccagttc
cgccagcatcgctggaactgcaacaccctggacagagatcacagcctctttggccgggtc
ctcctccgaagtagtcgggaatcggcctttgtttacgccatctcttcagctggcgttgta
tttgccatcaccagggcctgtagccaaggagaattaaagtcctgctcctgtgatccaaag
aagaaaggaagtgccaaggacagcaaaggcacctttgactggggtggctgcagtgacaat
attgactacgggatcaagtttgcccgtgcctttgtagatgccaaggagaggaaaggcaag
gatgccagagccctgatgaaccttcacaacaacagagctggaaggaaggctgtaaagcgc
ttcttgaaacaagaatgcaagtgtcatggtgtgagtggctcgtgtactctgaggacatgc
tggctggccatggctgacttcaggaaaacaggcgactatctctggaggaagtacaatggg
gccatccaggtagtcatgaaccaggatggcactggcttcactgtagccaataagaggttc
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggtcgtgtgtgcaacttgacttcccgaggc
atggacagctgcgaagttatgtgttgtgggagaggctatgacacatcccatgtcacccgg
atgaccaagtgtgagtgtaaattccactggtgctgtgccgtgcgctgtcaggactgcctg
gaggccctggacgtgcacacatgcaaggcccccaagagtgccgactgggcgactcctaca
tga

KEGG   Mus caroli (Ryukyu mouse): 110296669
Entry
110296669         CDS       T05910                                 

Gene name
Wnt7a
Definition
(RefSeq) protein Wnt-7a isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110296669 (Wnt7a)
   04390 Hippo signaling pathway
    110296669 (Wnt7a)
   04150 mTOR signaling pathway
    110296669 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110296669 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110296669 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296669 (Wnt7a)
   05205 Proteoglycans in cancer
    110296669 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110296669 (Wnt7a)
   05226 Gastric cancer
    110296669 (Wnt7a)
   05217 Basal cell carcinoma
    110296669 (Wnt7a)
   05224 Breast cancer
    110296669 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296669 (Wnt7a)
   05022 Pathways of neurodegeneration - multiple diseases
    110296669 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110296669 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110296669 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110296669 (Wnt7a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110296669 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 110296669
NCBI-ProteinID: XP_021021050
Ensembl: MGP_CAROLIEiJ_G0028652
UniProt: A0A6P5PVZ1
LinkDB
Position
6
AA seq 349 aa
MTRKARRCLGHLFLSLGIVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatagtctac
ctccggatcggtggcttctcttcggtggtagctctgggtgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggccggacgccatcatc
gtcataggagaaggctcccaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgttggaactgctcagcgctgggagagcgtactgtctttgggaaggagctcaaagtaggg
agtcgggaggctgccttcacctatgcgattattgctgcgggcgtggcccatgccatcact
gctgcctgcacccagggcaacctgagcgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtcttcgtggatgcccgggagatcaagcagaatgcccggacgctcatg
aacttacacaataacgaggcgggtcggaagatcctggaggagaacatgaagctggagtgt
aagtgccatggtgtgtcaggctcctgtaccactaagacgtgctggaccacactgccacag
ttccgagagctaggctacgtgctcaaggacaaatacaacgaggccgtccacgtggagcct
gtgcgtgccagtcgaaacaagcggcccacctttctgaagatcaagaagcccctgtcctac
cgcaagcccatggacactgacctggtgtacatcgagaagtcacccaattactgtgaagag
gacccagtgacaggcagcgtgggtacccagggtcgagcctgcaataagacagcccctcag
gccagtggctgtgacctcatgtgctgtggccgtggctacaacacgcaccagtacgcccgg
gtgtggcagtgcaactgcaaattccactggtgctgctatgtcaagtgtaacacgtgcagc
gagcgcacggagatgtatacntgcaagtga

KEGG   Mus caroli (Ryukyu mouse): 110296883
Entry
110296883         CDS       T05910                                 

Gene name
Wnt16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110296883 (Wnt16)
   04390 Hippo signaling pathway
    110296883 (Wnt16)
   04150 mTOR signaling pathway
    110296883 (Wnt16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110296883 (Wnt16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110296883 (Wnt16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296883 (Wnt16)
   05202 Transcriptional misregulation in cancer
    110296883 (Wnt16)
   05205 Proteoglycans in cancer
    110296883 (Wnt16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110296883 (Wnt16)
   05226 Gastric cancer
    110296883 (Wnt16)
   05217 Basal cell carcinoma
    110296883 (Wnt16)
   05224 Breast cancer
    110296883 (Wnt16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296883 (Wnt16)
   05022 Pathways of neurodegeneration - multiple diseases
    110296883 (Wnt16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110296883 (Wnt16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110296883 (Wnt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110296883 (Wnt16)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110296883 (Wnt16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110296883
NCBI-ProteinID: XP_021021341
Ensembl: MGP_CAROLIEiJ_G0028131
UniProt: A0A6P5Q420
LinkDB
Position
6
AA seq 364 aa
MDRAALLALPSLCALWAAVLSLLPCGTQGNWMWLGIASFGVPEKLGCADLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETA
FIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSEGWHWGGCSDDVQYGMWFSRK
FLDLPIRNTTGKESRVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSS
FEKIGHVLKDKYENSIQISDKTKRKMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLG
IPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDV
HTCK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacagagcggcgctcctggccctgcccagcttgtgtgcgctgtgggcagctgtgctg
tcgctgctcccctgcggaacccagggcaactggatgtggttgggcatcgcctctttcggg
gtaccggagaagctgggctgcgccgacttgccgctgaacagccgccagaaggagctgtgc
aagagaaaaccgtacctgctgcctagcatccgcgagggcgccagactgggcattcaggag
tgcagaagccagttccgacacgagaggtggaactgtatggtcgccactaccacttccacc
cagctcgccacagcccccctctttggctatgagctgagtagcggcaccaaggagacagca
ttcatttatgccatcatggcagcgggcctggtgcactctgtcaccaggtcatgcagtgca
ggcaacatgaccgaatgctcctgtgataccaccttgcagaatggtggctcaccaagtgaa
ggctggcactggggaggatgttctgatgatgtccagtacggcatgtggttcagccgaaag
tttctagatcttcccatcagaaacaccacaggaaaagaaagcagagtcctgctagccatg
aatctgcacaacaacgaagcggggcggcaggctgtcgccaagttaatgtctgtggactgc
cgctgccacggagtttccggctcctgtgctgtgaaaacctgctggaaaactatgtcttct
tttgaaaagattgggcatgttttaaaggataaatatgaaaacagcatccagatctcagac
aaaaccaagaggaaaatgcgcaggagagaaaaagaccagaggcagacccccattctcaag
gatgacttgctgtacgttcataagtctcccaactactgcgtggagaacaagaaactgggg
attcctgggacccagggcagagagtgcaaccggacatcaggaggcgcggatggctgtaac
ctcctctgctgtggccgaggctacaacacccatgtagtcaggcacgtggagagatgtgag
tgtaagtttatctggtgctgctacgtccgctgcaggaggtgtgaaagtatgaccgatgtc
cacacgtgtaagtaa

KEGG   Mus caroli (Ryukyu mouse): 110298907
Entry
110298907         CDS       T05910                                 

Gene name
Wnt11
Definition
(RefSeq) protein Wnt-11 isoform X1
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110298907 (Wnt11)
   04390 Hippo signaling pathway
    110298907 (Wnt11)
   04150 mTOR signaling pathway
    110298907 (Wnt11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110298907 (Wnt11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110298907 (Wnt11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298907 (Wnt11)
   05205 Proteoglycans in cancer
    110298907 (Wnt11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110298907 (Wnt11)
   05226 Gastric cancer
    110298907 (Wnt11)
   05217 Basal cell carcinoma
    110298907 (Wnt11)
   05224 Breast cancer
    110298907 (Wnt11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110298907 (Wnt11)
   05022 Pathways of neurodegeneration - multiple diseases
    110298907 (Wnt11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110298907 (Wnt11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110298907 (Wnt11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110298907 (Wnt11)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110298907 (Wnt11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110298907
NCBI-ProteinID: XP_021024103
Ensembl: MGP_CAROLIEiJ_G0030021
UniProt: A0A6P7RFD8
LinkDB
Position
7
AA seq 354 aa
MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
TISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggctctgctctttgccttggcgctccacaccggc
gtgtgctatggcatcaagtggctggcactgtccaagactccggcagccttggcactgaat
cagacgcaacactgtaaacagctggagggcctggtgtctgcgcaggtgcagctctgccgc
agcaacctggagctcatgcgcaccatcgtgcacgccgcccggggggccatgaaggcctgc
cgtagggccttcgctgacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgcttgacctggagagaggtacccgggagtcagccttcgtgtatgccctgtcggccgcc
accatcagtcacaccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctacgtgcctccctggaaacgaagtgtaaatgccatggggtgtctggctcctgctccatc
cgcacctgttggaaggggctgcaagagctccaggatgtggctgctgacctcaagacccgc
tacctgtcagccacgaaggtggtacaccggcctatgggcactcgcaaacatttggtgccc
aaggacctggatatccggcctgtgaaggactcagaacttgtgtatctacagagctcccct
gatttctgcatgaagaatgagaaggtgggatcccatgggacccaagacaggcagtgcaac
aagacctccaacggcagtgacagctgcgacctcatgtgctgtgggcgcggctacaacccc
tacacggacagagtggtggagcgatgtcactgcaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgcacggtggagcgctatgtctgcaagtga

KEGG   Mus caroli (Ryukyu mouse): 110299810
Entry
110299810         CDS       T05910                                 

Gene name
Wnt6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110299810 (Wnt6)
   04390 Hippo signaling pathway
    110299810 (Wnt6)
   04150 mTOR signaling pathway
    110299810 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110299810 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110299810 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299810 (Wnt6)
   05205 Proteoglycans in cancer
    110299810 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110299810 (Wnt6)
   05226 Gastric cancer
    110299810 (Wnt6)
   05217 Basal cell carcinoma
    110299810 (Wnt6)
   05224 Breast cancer
    110299810 (Wnt6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110299810 (Wnt6)
   05022 Pathways of neurodegeneration - multiple diseases
    110299810 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110299810 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110299810 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299810 (Wnt6)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110299810 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110299810
NCBI-ProteinID: XP_021025342
Ensembl: MGP_CAROLIEiJ_G0014274
UniProt: A0A6P5Q6P0
LinkDB
Position
1
AA seq 364 aa
MLPPVPSRLGLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEV
VAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVT
QACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDE
KSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLP
PFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCSPNRRTG
SPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKEL
SLCL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgctgccgccggtgccctcccgcctcggactgctgctgctgctcttgtgccccgcgcac
gtcggtggactgtggtgggccgtgggcagccccctggtcatggatcctaccagcatctgc
aggaaggccaggcggctggcaggaaggcaggccgagctgtgccaggcggagccggaagta
gtggcagagcttgcccgaggcgcaagactgggggttcgagaatgtcagttccagttccgt
ttccgacgctggaactgctccagtcacagcaaggcctttgggcgcgtcctgcagcaggac
atccgagagacagctttcgtgtttgcaatcaccgcagccggtgccagccacgcggtcact
caagcctgttccatgggagagctcctacagtgtggttgtcaggcaccccgcgggcgggca
ccgcctagaccctccggccttctgggcactcctggacctccaggaccaactggctctcca
gatgctagcgcagcctgggagtggggaggctgcggagacgatgtggacttcggggatgag
aagtcaagactctttatggacgcgcagcacaagcggggccgtggagatatccgtgcattg
gtgcaactgcacaacaacgaggcgggcaggctggcggtgcggagccacacgcgcaccgag
tgtaagtgccacgggctttcgggttcctgcgctctgcgcacctgctggcagaagctgcct
ccgttccgcgaggtgggcgcacggctgctggagcgcttccacggcgcctcgcgcgtcatg
ggcaccaacgacggcaaagctctgctgcctgcggtccgcacactcaagcctcccggacga
gcggatctcctctacgcagccgattcacccgacttctgctccccaaaccggcgcaccggt
tcgccgggcacgcgcggacgcgcctgcaacagcagtgccccggacctcagcggctgcgac
ctgttgtgctgcggtcgcgggcaccgccaggagagcgtacagctcgaggagaactgtctg
tgccgcttccactggtgctgcgtggtgcaatgccaccgctgccgggtgcgcaaggaactc
agcctgtgcctctga

KEGG   Mus caroli (Ryukyu mouse): 110300434
Entry
110300434         CDS       T05910                                 

Gene name
Wnt10a
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110300434 (Wnt10a)
   04390 Hippo signaling pathway
    110300434 (Wnt10a)
   04150 mTOR signaling pathway
    110300434 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110300434 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110300434 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300434 (Wnt10a)
   05205 Proteoglycans in cancer
    110300434 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110300434 (Wnt10a)
   05226 Gastric cancer
    110300434 (Wnt10a)
   05217 Basal cell carcinoma
    110300434 (Wnt10a)
   05224 Breast cancer
    110300434 (Wnt10a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110300434 (Wnt10a)
   05022 Pathways of neurodegeneration - multiple diseases
    110300434 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110300434 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110300434 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110300434 (Wnt10a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110300434 (Wnt10a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110300434
NCBI-ProteinID: XP_021026270
Ensembl: MGP_CAROLIEiJ_G0014275
UniProt: A0A6P5Q8Z2
LinkDB
Position
1
AA seq 417 aa
MGSAHPRPWLRLPPGPQPRPEFWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPAILPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSTGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctcccaccagggccccagccgcggcct
gagttctgggcgctcctgttcttcctactgctgctggctgccgctgtgcccaggtcagca
cccaacgacatcctgggcctccgcctacccccagagcctgtgctcaacgccaacacagtg
tgcctgacattgcccggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgac
gtggccgcctctgctatccagggcatccagatcgccatccatgagtgccagcatcagttc
cgggaccagcgctggaactgctccagcctggagactcggaacaaagtcccctacgagagc
cccatcttcagccgaggttttcgagagagtgctttcgcctacgccatagcagctgctggg
gtggtgcacgcagtgtccaacgcgtgcgctctgggtaaactgaaggcttgcggttgcgac
gcctccaggcgtggggacgaagaagccttccgtcggaagctgcaccgcttgcagctggac
gcactgcagcgcggaaagggcttgagccacggggtccctgaacacccggccatactccct
gctagcccaggtctgcaggactcctgggagtggggtggctgcagtccggatgtgggcttc
ggagaacgcttctctaaggactttctggactcccgagagcctcacagagacatccatgct
cgaatgagactccacaacaaccgtgtgggccggcaggcggtgatggagaacatgcggcgt
aagtgcaaatgccacggcacctcaggcagctgccagctcaagacctgctggcaggtgacg
cctgagttccgcacagtaggggcgctgctgcgcaaccgattccaccgcgccacgctcatc
cggccgcacaaccgcaacggtggccagctggagcccggccccgcgggagcaccctcgcca
gcaccgggcactccagggctgcgccgcagggccagccactccgacttggtctactttgag
aaatcccccgacttctgtgagcgcgagccgcgcctggactcggcaggcactgtgggccgc
ctgtgcaataagagcagcacgggtcccgatggctgcggcagcatgtgctgtggccgcggc
cacaacattctgcgccagacgcgcagcgagcgctgccactgccggttccactggtgctgc
ttcgtggtctgcgaagaatgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Mus caroli (Ryukyu mouse): 110304911
Entry
110304911         CDS       T05910                                 

Gene name
Wnt3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110304911 (Wnt3)
   04390 Hippo signaling pathway
    110304911 (Wnt3)
   04150 mTOR signaling pathway
    110304911 (Wnt3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110304911 (Wnt3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110304911 (Wnt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304911 (Wnt3)
   05206 MicroRNAs in cancer
    110304911 (Wnt3)
   05205 Proteoglycans in cancer
    110304911 (Wnt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110304911 (Wnt3)
   05226 Gastric cancer
    110304911 (Wnt3)
   05217 Basal cell carcinoma
    110304911 (Wnt3)
   05224 Breast cancer
    110304911 (Wnt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110304911 (Wnt3)
   05022 Pathways of neurodegeneration - multiple diseases
    110304911 (Wnt3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304911 (Wnt3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304911 (Wnt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110304911 (Wnt3)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110304911 (Wnt3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110304911
NCBI-ProteinID: XP_021032255
Ensembl: MGP_CAROLIEiJ_G0017286
UniProt: A0A6P5QMX9
LinkDB
Position
11
AA seq 355 aa
MEPHLLGLLLGLLLSGTRVLAGYPIWWSLALGQQYTSLASQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctactcggcctcctgctcagtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctggcctcc
cagcctctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtagcagaaggtgtgaagctgggcatccaggagtgc
cagcatcagttccggggccgccgctggaactgtaccaccatagatgacagcctggccatc
tttgggcctgtcttggacaaagccacccgtgaatctgccttcgtgcatgccatcgcctcg
gctggtgtcgccttcgcagtcacacgctcctgcgctgagggaacctccaccatctgcggc
tgtgactcacatcataaggggccacctggagaaggctggaagtggggcggctgcagcgag
gacgccgacttcggggtgctggtgtcccgggagtttgcggatgcgcgggagaacaggcca
gatgcccgctcagctatgaacaagcacaacaatgaagcaggccgaacgaccatcctggac
cacatgcacctaaagtgtaaatgccacgggttgtccggcagctgcgaggtgaagacctgc
tggtgggcccagcccgacttccgggccattggcgacttcctcaaggacaagtacgacagt
gcctctgagatggtggtggagaaacaccgtgaatcccgaggctgggtggagaccctgcgg
gctaagtacgcgctcttcaagccgcccaccgagagggacctggtctactatgagaactct
cctaacttttgtgagcccaacccagagacaggctcctttggtaccagggaccggacttgc
aatgtcacctcccacggcatcgatggctgtgatctgctgtgctgtggccggggccacaac
acgaggacggagaagcggaaggagaaatgccattgcgtcttccactggtgctgctatgtc
agctgccaagagtgtattcgcatctacgatgtgcacacctgcaagtag

KEGG   Mus caroli (Ryukyu mouse): 110305853
Entry
110305853         CDS       T05910                                 

Gene name
Wnt3a
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110305853 (Wnt3a)
   04390 Hippo signaling pathway
    110305853 (Wnt3a)
   04150 mTOR signaling pathway
    110305853 (Wnt3a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110305853 (Wnt3a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110305853 (Wnt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305853 (Wnt3a)
   05206 MicroRNAs in cancer
    110305853 (Wnt3a)
   05205 Proteoglycans in cancer
    110305853 (Wnt3a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110305853 (Wnt3a)
   05226 Gastric cancer
    110305853 (Wnt3a)
   05217 Basal cell carcinoma
    110305853 (Wnt3a)
   05224 Breast cancer
    110305853 (Wnt3a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110305853 (Wnt3a)
   05022 Pathways of neurodegeneration - multiple diseases
    110305853 (Wnt3a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110305853 (Wnt3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305853 (Wnt3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110305853 (Wnt3a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110305853 (Wnt3a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110305853
NCBI-ProteinID: XP_021033645
Ensembl: MGP_CAROLIEiJ_G0016432
UniProt: A0A6P5QR86
LinkDB
Position
11
AA seq 352 aa
MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggctcctctcggatacctcttagtgctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtccttggctgtgggaccccagtactcctctctgagcactcagcccatt
ctctgtgccagcatcccaggcctggtgcccaagcagctgcgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggtgtcaaagcgggcatccaggagtgccagcaccag
ttccgaggccggcgttggaactgcaccaccgtcagcaacagcctggccatctttggccct
gttctggacaaagccacccgggagtcagcctttgtccatgccatcgcctccgctggagtg
gcctttgcagtgacacgctcctgtgcagagggatcagctgccatctgtgggtgcagcagc
cgcctccagggctccccaggagagggctggaagtggggcggctgtagtgaggacattgaa
tttggaggaatggtctctcgggagtttgctgatgccagggagaaccggccggatgcccgc
tctgccatgaaccgtcacaacaatgaggctgggcgccaggccatcgccagtcacatgcac
ctcaagtgcaaatgccacgggctatctggcagctgtgaagtgaagacctgctggtggtcg
cagccggacttccgcaccatcggggatttcctcaaggacaagtatgacagcgcctcagag
atggtggtagagaaacaccgagagtctcgtggctgggtggagaccctgaggccacgttac
acgtacttcaaggtgccgacagagcgcgacctggtctactatgaggcctcacccaacttc
tgcgagcctaaccctgaaaccggctctttcgggacgcgtgaccgcacctgcaatgtgagc
tcgcatggcatagatgggtgcgacctgctgtgctgcgggcgcgggcataacgcgcgcact
gagcgacggagggagaaatgccactgtgttttccattggtgctgctacgtcagctgccag
gagtgcacacgtgtctatgacgtgcacacctgcaagtag

KEGG   Mus caroli (Ryukyu mouse): 110305968
Entry
110305968         CDS       T05910                                 

Gene name
Wnt9b
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110305968 (Wnt9b)
   04390 Hippo signaling pathway
    110305968 (Wnt9b)
   04150 mTOR signaling pathway
    110305968 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110305968 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110305968 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305968 (Wnt9b)
   05205 Proteoglycans in cancer
    110305968 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110305968 (Wnt9b)
   05226 Gastric cancer
    110305968 (Wnt9b)
   05217 Basal cell carcinoma
    110305968 (Wnt9b)
   05224 Breast cancer
    110305968 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110305968 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    110305968 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110305968 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305968 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110305968 (Wnt9b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110305968 (Wnt9b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110305968
NCBI-ProteinID: XP_021033813
Ensembl: MGP_CAROLIEiJ_G0017285
UniProt: A0A6P5QJW9
LinkDB
Position
11
AA seq 359 aa
MRPASALALAALCLLALPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLL
KLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAF
LYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLG
PKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVL
KLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSP
GTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgccccgcgtccgcgctggccctggctgcgctctgcctgctggcgctgcctgctgcc
gccgccgccgccgcctacttcggcctgaccggtcgtgaggtcctgacgcccttcccaggc
ctgggtacggcagcagccccagcacaggctggtgctcacctgaagcagtgtgacctactg
aagctgtccaggcggcagaagcagctctgcaggcgggagcctggcctggctgagactctg
agggatgctgcacacctggggctgctggaatgtcagttccagttcaggcaggagcgctgg
aactgcagcctggaggggaggactggcctgctccagagaggctttaaggagacagccttc
ctgtatgcagtgtctgcagctgccctcacgcatgcactggccagggcctgcagtgctggg
cgcatggagcgctgcacctgtgacgactccccaggcctggagagccggcaggcctggcag
tggggggtgtgtggtgacaatctgaagtacagcacaaagttcctcagcaacttcctgggg
cccaagagaggaagcaaggacctgagggcgagggctgacgcccacaacacccatgtgggc
atcaaggctgtgaagagcggcctgagaacaacctgcaagtgccatggtgtgtcaggctcc
tgtgctgtgcgtacctgttggaagcagctctccccgtttcgcgagactggtcaggtgctg
aagctacgctatgacacagctgtcaaggtgtccagtgccaccaacgaggccttgggtcgt
ctggagctatgggcccccgctaagccaggtggtcccgccaagggcctagctcctcgtccg
ggggacctggtctacatggaagattctcccagcttctgccggcccagcaagtactctccg
ggcacggcaggcagggtgtgttctcgagactccagctgcagcagcctatgctgtgggcga
ggctatgacacccagagccgcatggtggttttctcctgccactgtcaggtgcagtggtgc
tgctacgtggagtgccagcagtgtgcacagcaggagctcgtgtatacctgcaagcgctag

KEGG   Mus caroli (Ryukyu mouse): 110306039
Entry
110306039         CDS       T05910                                 

Gene name
Wnt9a
Definition
(RefSeq) protein Wnt-9a isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110306039 (Wnt9a)
   04390 Hippo signaling pathway
    110306039 (Wnt9a)
   04150 mTOR signaling pathway
    110306039 (Wnt9a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110306039 (Wnt9a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110306039 (Wnt9a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306039 (Wnt9a)
   05205 Proteoglycans in cancer
    110306039 (Wnt9a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110306039 (Wnt9a)
   05226 Gastric cancer
    110306039 (Wnt9a)
   05217 Basal cell carcinoma
    110306039 (Wnt9a)
   05224 Breast cancer
    110306039 (Wnt9a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110306039 (Wnt9a)
   05022 Pathways of neurodegeneration - multiple diseases
    110306039 (Wnt9a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110306039 (Wnt9a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110306039 (Wnt9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110306039 (Wnt9a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110306039 (Wnt9a)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 110306039
NCBI-ProteinID: XP_021033890
Ensembl: MGP_CAROLIEiJ_G0016433
UniProt: A0A6P5QRT3
LinkDB
Position
11
AA seq 365 aa
MLDGSLLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLETEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETSLKVGSTTNEATGEAGAISPPRGRASGSGGGDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtcccttctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctaacaggcagtgaacccctgact
atcctccctctgaccctggagactgaggctgcggcccaagcacactacaaggcctgcgac
aggctgaagctggagcgcaagcagcgccgcatgtgccgcagggacccgggtgtggccgag
acactggtggaggccgtaagcatgagtgccctggagtgccagtaccagttccgctttgag
cgctggaactgcaccctggagggccgctaccgagccagcctgctcaagcgaggcttcaag
gagactgctttcctctacgccatctcttctgcgggcctgacgcatgcactggccaaggcc
tgcagcgcaggccgcatggagcgctgcacgtgtgatgaggcgcccgacctggaaaatcgt
gaggcctggcagtggggcggctgcggggacaacctcaagtacagcagcaagtttgtcaag
gagttcctgggccggcgctctagcaaggatttgcgagcccgagtggacttccacaacaac
ctcgtgggtgtgaaggtgataaaggctggagtggaaaccacttgcaaatgtcatggtgtg
tctggctcctgcaccgtgcggacctgctggcggcagctagcacccttccacgaggtgggc
aagcacctaaaacacaaatatgagacctcgctcaaggtgggcagcactaccaatgaagcc
actggagaggcaggtgccatctccccaccgcggggccgggcttctgggtcaggaggtggc
gacccactaccccgaacaccagagcttgtacacctggatgactctcccagcttctgcctg
gctggccgcttttcccctggcacggcaggccgcaggtgtcaccgggagaagaactgtgag
agtatttgttgtggccgaggccacaacacacagagccgtgtggtgacaaggccctgccaa
tgccaggtccgctggtgctgctacgtggagtgcaggcagtgtacacagagagaggaggtc
tatacctgcaagggctga

KEGG   Mus caroli (Ryukyu mouse): 110309360
Entry
110309360         CDS       T05910                                 

Gene name
Wnt5a
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110309360 (Wnt5a)
   04390 Hippo signaling pathway
    110309360 (Wnt5a)
   04150 mTOR signaling pathway
    110309360 (Wnt5a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110309360 (Wnt5a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110309360 (Wnt5a)
  09158 Development and regeneration
   04360 Axon guidance
    110309360 (Wnt5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309360 (Wnt5a)
   05205 Proteoglycans in cancer
    110309360 (Wnt5a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110309360 (Wnt5a)
   05226 Gastric cancer
    110309360 (Wnt5a)
   05217 Basal cell carcinoma
    110309360 (Wnt5a)
   05224 Breast cancer
    110309360 (Wnt5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110309360 (Wnt5a)
   05022 Pathways of neurodegeneration - multiple diseases
    110309360 (Wnt5a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110309360 (Wnt5a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110309360 (Wnt5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110309360 (Wnt5a)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110309360 (Wnt5a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110309360
NCBI-ProteinID: XP_021037635
Ensembl: MGP_CAROLIEiJ_G0019042
UniProt: A0A6P5QZX9
LinkDB
Position
14
AA seq 391 aa
MELILAPLVAPAQKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSL
GMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFR
HRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAAR
PKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
VYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNS
RFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKT
VQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaattaattctggctccacttgttgctccggcccagaagcccattggaatattaagc
ccgggagtggctttggggaccgctggaggtgccatgtcttccaagttcttcctaatggct
ttggccacgtttttctccttcgcccaggttgttatagaagctaattcttggtggtctcta
ggtatgaataaccctgttcagatgtcagaagtatatatcataggtgcacagcctctctgc
agccaactggcaggactttctcaaggacagaagaaactctgccacttgtatcaggaccac
atgcagtacattggagaaggtgcgaagacaggcatcaaggaatgccagtaccagttccgg
catcggagatggaactgcagcacagtggacaatacttctgtctttggcagggtgatgcaa
ataggcagccgagagacggccttcacgtacgcggtgagcgcagctggggtggtgaacgcc
atgagccgagcatgccgggagggcgagctgtctacctgtggctgcagccgcgctgcgcgc
cccaaggacctgcctcgggactggttgtggggcggctgcggagacaacatcgactatggc
taccgcttcgccaaggagtttgtggacgctagagaaagggaacgaatccacgccaagggc
tcctatgagagcgcacgcatcctcatgaacttacacaacaatgaagcaggccgcaggaca
gtatacaacctggcagatgtagcctgtaagtgtcatggagtgtctggctcctgtagcctc
aagacttgctggctgcagctggcggacttccggaaggtgggcgatgccctcaaggagaag
tatgatagcgcagcggccatgaggctcaacagccggggcaagctggtgcaggtcaacagc
cgcttcaactccccgaccacccaggacctggtctacatcgacccaagtccggactactgt
gtgcgcaacgagagcactggctcgctgggcacgcagggacgcctgtgcaacaagacctca
gaggggatggacggctgcgagctcatgtgctgtgggcgtggctatgaccagtttaagaca
gtgcagaccgaacgctgtcattgcaagtttcactggtgctgctatgtcaaatgcaagaag
tgcacggagattgtggatcagttcgtgtgcaaatag

KEGG   Mus caroli (Ryukyu mouse): 110310689
Entry
110310689         CDS       T05910                                 

Gene name
Wnt7b
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310689 (Wnt7b)
   04390 Hippo signaling pathway
    110310689 (Wnt7b)
   04150 mTOR signaling pathway
    110310689 (Wnt7b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310689 (Wnt7b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110310689 (Wnt7b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310689 (Wnt7b)
   05205 Proteoglycans in cancer
    110310689 (Wnt7b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110310689 (Wnt7b)
   05226 Gastric cancer
    110310689 (Wnt7b)
   05217 Basal cell carcinoma
    110310689 (Wnt7b)
   05224 Breast cancer
    110310689 (Wnt7b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110310689 (Wnt7b)
   05022 Pathways of neurodegeneration - multiple diseases
    110310689 (Wnt7b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310689 (Wnt7b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310689 (Wnt7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110310689 (Wnt7b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110310689 (Wnt7b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110310689
NCBI-ProteinID: XP_021039466
Ensembl: MGP_CAROLIEiJ_G0020128
UniProt: A0A6P5R428
LinkDB
Position
15
AA seq 353 aa
MLLLSPRSALVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctcctgtcgccgcgcagcgcgctggtctccgtctattgcccgcagatctttctc
cttctgtccagcggcagttacctagcattgtcatccgtggtggccctgggagccaacatc
atctgcaacaagattcctggcctggccccacggcagcgtgccatctgccagagccgaccc
gatgccatcattgtgatcggggagggggcgcagatgggcatcgacgagtgccagcaccag
ttccgatttggccgctggaactgctccgccctgggcgagaagaccgtcttcgggcaagaa
ctccgagtagggagtcgagaggctgccttcacctatgccatcacggcggcaggagtggcg
catgccgtcaccgctgcctgcagccagggaaatctgagcaattgtggctgtgaccgggag
aagcaaggctactacaaccaggcggaaggctggaagtgggggggctgctcagctgacgtc
cgctacggcatcgacttttctcgtcgctttgtggatgcccgtgagatcaagaagaatgcc
aggcgcctcatgaaccttcacaacaatgaggcgggcagaaaggttctggaggaccgcatg
aagctggaatgtaagtgtcacggtgtgtcaggctcctgtaccaccaaaacctgctggacc
acgctacctaagttccgcgaggtgggccacctgctcaaggagaagtacaacgcagccgtg
caggtggaggtggtgcgagccagccgcctgcgccagcccaccttcctgcgcatcaagcag
ctacgcagctaccagaagcctatggagacggacctggtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccaccggcagcgtgggcacgcaggggcgtctgtgcaaccgc
acctcgcctggggccgacggctgtgacaccatgtgctgcggccgcggctacaacacgcac
cagtacaccaaggtgtggcagtgcaactgcaaattccactggtgttgcttcgtcaagtgc
aacacgtgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Mus caroli (Ryukyu mouse): 110310912
Entry
110310912         CDS       T05910                                 

Gene name
Wnt10b
Definition
(RefSeq) protein Wnt-10b isoform X1
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310912 (Wnt10b)
   04390 Hippo signaling pathway
    110310912 (Wnt10b)
   04150 mTOR signaling pathway
    110310912 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310912 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110310912 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310912 (Wnt10b)
   05205 Proteoglycans in cancer
    110310912 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110310912 (Wnt10b)
   05226 Gastric cancer
    110310912 (Wnt10b)
   05217 Basal cell carcinoma
    110310912 (Wnt10b)
   05224 Breast cancer
    110310912 (Wnt10b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110310912 (Wnt10b)
   05022 Pathways of neurodegeneration - multiple diseases
    110310912 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310912 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310912 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110310912 (Wnt10b)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110310912 (Wnt10b)
SSDB
Motif
Pfam: wnt DUF5586
Other DBs
NCBI-GeneID: 110310912
NCBI-ProteinID: XP_021039742
Ensembl: MGP_CAROLIEiJ_G0020245
UniProt: A0A6P5RAQ1
LinkDB
Position
15
AA seq 389 aa
MLEEPRSRPPPLGLAGLLFLALFSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSP
VPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggtctcggcctccgcccttaggcctcgcgggtctcctgttcttg
gctttgttcagtcgggctctaagcaatgagattctgggccttaaacttcccggtgagccg
ccgctgacggccaacaccgtgtgcttgaccctgtccggactgagtaagcgacagctgggg
ctgtgcctgcgcagccccgacgtgacggcgtccgcgctccaggggctgcacatcgccgtt
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcactggagggcggc
ggccggctgccgcaccacagcgccatcctcaagcgcggtttccgcgagagtgcgttctcc
ttctccatgctggctgctggggtcatgcatgctgttgccacagcctgcagcctgggcaag
ctggtgagctgtggctgcggctggaagggtagtggtgagcaagaccggcttcgagccaag
ctgctgcagcttcaggcactgtctcggggcaagactttccccatctcccagcccagccct
gttcctggctcagtccccagcccgggcccccaggacacgtgggaatggggtggctgtaac
cacgacatggacttcggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcgagaatgcggatccacaacaacagggtgggacgccaggtggtaacg
gaaaacctgaagcggaagtgcaaatgccatgggacttcaggcagctgccaattcaagacc
tgttggagggcagcgccagagttccgggccatcggggcagcactgagggagcggctgagc
agagccatctttatcgatacccacaaccgcaactctggagcgttccagccccgcctccgt
ccgaggcgcctctccggagagctggtttactttgagaagtctcctgacttctgtgagcga
gaccctactttgggctccccaggcacgagaggccgggcttgcaacaagaccagccgcctc
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtgctccggcagacgcga
gtggagcgctgccactgtcgattccactggtgctgttatgtgctgtgtgatgagtgtaaa
gtcacggagtgggtcaatgtgtgtaagtga

KEGG   Mus caroli (Ryukyu mouse): 110310964
Entry
110310964         CDS       T05910                                 

Gene name
Wnt1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310964 (Wnt1)
   04390 Hippo signaling pathway
    110310964 (Wnt1)
   04150 mTOR signaling pathway
    110310964 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310964 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110310964 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310964 (Wnt1)
   05205 Proteoglycans in cancer
    110310964 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110310964 (Wnt1)
   05226 Gastric cancer
    110310964 (Wnt1)
   05217 Basal cell carcinoma
    110310964 (Wnt1)
   05224 Breast cancer
    110310964 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110310964 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    110310964 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310964 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310964 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110310964 (Wnt1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110310964 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110310964
NCBI-ProteinID: XP_021039815
Ensembl: MGP_CAROLIEiJ_G0020246
UniProt: A0A6P5R4Y6
LinkDB
Position
15
AA seq 370 aa
MGLWALLPSWVSATLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgctgcccagctgggtttctgctacgttgctactggcactgacc
gctctgcccgcagccctggctgccaacagtagtggccgatggtggggcatcgtgaacata
gcctcctccacgaacctgctgacggattccaagagtctgcagctggtgctggagcccagt
ctgcagctgctgagccgcaagcagcggcgactgatccgacagaacccggggatcctgcac
agcgtgagtggagggctgcagagcgccgtgcgagagtgcaagtggcaatttcgaaaccgc
cgctggaactgccccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgccgagaaacagcgttcatcttcgcaatcacctccgccggggtcacacattccgtagcg
cgctcctgctccgaaggctccatcgagtcctgcacctgcgactaccggcggcgcggccct
ggaggccccgactggcactgggggggctgcagtgacaacattgattttggtcgcctcttt
ggccgagagttcgtggactctggggagaaggggcgggacctacgcttcctcatgaacctt
cacaacaacgaggcagggcgaacgaccgtgttctctgagatgcgccaagagtgcaaatgc
cacgggatgtccggctcctgcacggtgcgcacgtgttggatgcggctgcccacgctgcgc
gctgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcccgcgtcctttatggcaac
cgaggcagcaaccgcgcctcgcgggcggagctgctgcgcctggagcccgaagaccccgcg
cacaagcctccctcccctcacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagtggccgcctgggcacagctggcacagctgggcgagcttgcaacagctcgtctccc
gcgctggacggctgcgagctgctgtgctgtggccgaggccaccgcacgcgcacgcagcgc
gtcacggagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgttctgcacgagtgtctatga

DBGET integrated database retrieval system