KEGG   Mus caroli (Ryukyu mouse): 110285141
Entry
110285141         CDS       T05910                                 

Gene name
Hbegf
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110285141 (Hbegf)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110285141 (Hbegf)
   04915 Estrogen signaling pathway
    110285141 (Hbegf)
   04928 Parathyroid hormone synthesis, secretion and action
    110285141 (Hbegf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110285141 (Hbegf)
  09162 Cancer: specific types
   05219 Bladder cancer
    110285141 (Hbegf)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110285141 (Hbegf)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110285141 (Hbegf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110285141 (Hbegf)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110285141 (Hbegf)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 110285141
NCBI-ProteinID: XP_021006793
Ensembl: MGP_CAROLIEiJ_G0022125
UniProt: A0A6P7QS90
LinkDB
Position
18
AA seq 208 aa
MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTDQLLPTGVDRAQG
VQDLEGTDLDLFKVAFSSKPQALATPSKERNGKKKKKGKGLGKKRDPCLKKYKDYCIHGE
CRYLQEFHTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAIVLSSVCLLVIVG
LLMFRYHRRGGYDLESEEKVKLGVASSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtgatgctgaagctctttctggctgcagtgttgtccgcgttg
gtgaccggtgagagtctggagcggcttcggagaggtctggcggcagcaaccagcaaccct
gaccctcccactggatccacagaccagctgctacccacgggagttgatcgtgctcagggg
gtccaggacttagaagggacagatctggaccttttcaaagttgctttttcctccaagcca
caagccctggccaccccaagcaaagaaaggaatgggaaaaagaagaagaaaggaaagggg
ttaggaaagaagagagacccgtgcctcaagaaatacaaggactactgcatccatggggag
tgcagatacctgcaggagtttcatacgccctcttgcaaatgcctccctggttaccacgga
cacaggtgtcatgggctgactctaccggtggagaatcccctatacacatatgaccacact
acagtcttggctgtggtggctatagtactgtcgtctgtctgtcttcttgtcatcgtggga
cttctcatgtttaggtaccacaggagaggaggttatgacttggaaagtgaagagaaagtg
aagttgggtgtggctagctcccactga

DBGET integrated database retrieval system