KEGG   Mus caroli (Ryukyu mouse): 110285273
Entry
110285273         CDS       T05910                                 

Gene name
Tcf7l2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05132  Salmonella infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110285273 (Tcf7l2)
   04390 Hippo signaling pathway
    110285273 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110285273 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110285273 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285273 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110285273 (Tcf7l2)
   05225 Hepatocellular carcinoma
    110285273 (Tcf7l2)
   05226 Gastric cancer
    110285273 (Tcf7l2)
   05216 Thyroid cancer
    110285273 (Tcf7l2)
   05221 Acute myeloid leukemia
    110285273 (Tcf7l2)
   05217 Basal cell carcinoma
    110285273 (Tcf7l2)
   05215 Prostate cancer
    110285273 (Tcf7l2)
   05213 Endometrial cancer
    110285273 (Tcf7l2)
   05224 Breast cancer
    110285273 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110285273 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110285273 (Tcf7l2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110285273 (Tcf7l2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110285273 (Tcf7l2)
   05165 Human papillomavirus infection
    110285273 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110285273 (Tcf7l2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110285273 (Tcf7l2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110285273
NCBI-ProteinID: XP_021006959
Ensembl: MGP_CAROLIEiJ_G0023086
UniProt: A0A6P5P012
LinkDB
Position
19
AA seq 604 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGSLQSRQTLKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPHLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLL
AEAAHGKASALCPNGALDLPPAALQPSMVPSSSLAQPSTSSLHSHNSLAGTQPQPLSLVT
KSLE
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgctaacgacgagctgatctcc
ttcaaagacgaaggcgagcaggaggagaagaactcggaaaactcctcggcggaaagggat
ttagccgatgtcaagtcctcgctggtcaatgaatcagagacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcaatccggcagcactcattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgat
gtccaagcaggaagcctccagagcagacaaaccctcaaggatgctcgttcgccgtcgcca
gcacacatcgtttcgaacaaagtaccggtggtgcaacacccccaccatgtccacccactc
acgcctctcatcacgtacagcaatgaacacttcaccccgggaaatccacctccgcactta
ccagctgatgtagaccccaaaacaggaatcccaaggcctccgcaccctccagatatctct
ccatattacccgctgtcgcccggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcagcctgtgtacccaatcacgacaggaggattcagacacccctac
cccacagcgctgacagtcaacgcatctatgtctaggttccctccccatatggtccctccc
catcacactctgcacacgaccggcatccctcacccggccatcgtcacaccaacagtcaag
caggaatcctcccagagtgacgtcggctcactccacagctcaaagcatcaggactccaaa
aaggaagaagagaagaagaagccccacataaagaagccccttaatgcattcatgttgtat
atgaaggagatgagagcaaaggtggtggccgaatgcacactgaaagagagtgcagccatc
aaccagattctcgggcgcaggtggcacgccctgtccagggaagaacaggcaaagtactac
gagctggcccggaaggaacgacagcttcatatgcagctgtaccctggctggtctgcacgg
gataactatgggaagaagaagaagagaaaaagagacaagcagcctggggaaaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgaccgacagactttatggtgc
aaaccctgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agcccaccctcttcagatggaagcttactagactcgcctcccccctcaccgcatctgcta
ggctcccctccccaagacgccaagtcacagactgagcagacacagccgctctcgctgtcc
ctgaagcctgatcctctggcccacctgtccatgatgcctcctccacccgcgctcctgctg
gccgaagctgcccacggcaaggcctctgccctctgtcccaacggggctctggacctgcca
cctgccgctctgcagccgtccatggtcccttcctcatcgctcgcacaaccatcaacttct
tccttacattcccacaactcgctggctggaacgcaaccccagcctctgtctctggtgacc
aagtctttagaatag

KEGG   Mus caroli (Ryukyu mouse): 110290892
Entry
110290892         CDS       T05910                                 

Gene name
Lef1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05132  Salmonella infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110290892 (Lef1)
   04390 Hippo signaling pathway
    110290892 (Lef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110290892 (Lef1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110290892 (Lef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290892 (Lef1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110290892 (Lef1)
   05225 Hepatocellular carcinoma
    110290892 (Lef1)
   05226 Gastric cancer
    110290892 (Lef1)
   05216 Thyroid cancer
    110290892 (Lef1)
   05221 Acute myeloid leukemia
    110290892 (Lef1)
   05217 Basal cell carcinoma
    110290892 (Lef1)
   05215 Prostate cancer
    110290892 (Lef1)
   05213 Endometrial cancer
    110290892 (Lef1)
   05224 Breast cancer
    110290892 (Lef1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110290892 (Lef1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110290892 (Lef1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110290892 (Lef1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110290892 (Lef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110290892 (Lef1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110290892 (Lef1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110290892
NCBI-ProteinID: XP_021013413
Ensembl: MGP_CAROLIEiJ_G0025637
UniProt: A0A6P5PF96
LinkDB
Position
3
AA seq 412 aa
MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE
IIPASNGHEVVRQAPSSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNS
DPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQ
GMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSGDTSMSRF
SHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKP
LNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQL
YPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgccccaactttccggaggcggcggcgggggggacccggaactctgcgccaccgatgag
atgatccccttcaaggacgaaggcgatccccagaaggagaagatcttcgccgagatcagt
caccccgaagaagagggcgacttagccgacatcaagtcatccttggttaacgagtccgaa
atcatcccagccagcaacgggcatgaggtggtcagacaagccccgtcctctcaggagccc
taccacgacaaggccagagaacaccctgatgacggaaagcatccagacggaggcctgtac
aacaagggaccctcctactccagttactctggctacataatgatgcccaatatgaacagc
gacccgtacatgtcaaatgggtccctttctccacccatcccgaggacatcaaataaagtg
ccggtggtgcagccctctcacgcggtccacccgctcacccccctcatcacctacagcgac
gagcacttttctccgggatcccacccgtcacacatcccgtcagatgtcaactccaagcaa
ggcatgtccagacaccctccagctcctgaaatccccaccttctaccccctgtctccgggc
ggcgttggacagatcaccccaccccttggctggcaaggtcagcctgtttatcccatcacg
ggtggattcaggcaaccctacccatcctcactgtcaggcgacacttccatgtccaggttt
tcccatcatatgattcctggtccccctggcccccacacaactggcatccctcatccagct
attgtaacacctcaggtcaaacaggagcatccccacacggacagtgacctaatgcacgtg
aagcctcaacatgaacagagaaaggagcaggagccaaaaagacctcacattaagaagcct
ctgaatgctttcatgttatatatgaaagaaatgagagcgaatgtcgtagctgagtgtacc
ctaaaggagagtgcagctatcaaccagatcctgggcagaaggtggcacgccctctcccgg
gaagagcaggccaaatattatgaactagcacggaaagagagacagctacacatgcagctt
tatccaggctggtcagcgcgagacaattatggcaagaagaagaagaggaagagagagaag
ctacaggaatcgacttcaggtggtaagagaagctccttcccaacgtgcaaagccaaggca
gcgaccccaggccctcttctggagatggaagcttgttga

KEGG   Mus caroli (Ryukyu mouse): 110296038
Entry
110296038         CDS       T05910                                 

Gene name
Tcf7l1
Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05132  Salmonella infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110296038 (Tcf7l1)
   04390 Hippo signaling pathway
    110296038 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110296038 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110296038 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296038 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110296038 (Tcf7l1)
   05225 Hepatocellular carcinoma
    110296038 (Tcf7l1)
   05226 Gastric cancer
    110296038 (Tcf7l1)
   05216 Thyroid cancer
    110296038 (Tcf7l1)
   05221 Acute myeloid leukemia
    110296038 (Tcf7l1)
   05217 Basal cell carcinoma
    110296038 (Tcf7l1)
   05215 Prostate cancer
    110296038 (Tcf7l1)
   05213 Endometrial cancer
    110296038 (Tcf7l1)
   05224 Breast cancer
    110296038 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110296038 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110296038 (Tcf7l1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110296038 (Tcf7l1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296038 (Tcf7l1)
   05165 Human papillomavirus infection
    110296038 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110296038 (Tcf7l1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110296038 (Tcf7l1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 DUF1525
Other DBs
NCBI-GeneID: 110296038
NCBI-ProteinID: XP_021020196
Ensembl: MGP_CAROLIEiJ_G0028511
UniProt: A0A6P5Q0Y1
LinkDB
Position
6
AA seq 599 aa
MPQLGGGRGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLYGDPARW
MVPPTFRSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPS
ELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRF
PHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKP
LNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQL
YPTWSARDNYGKKKKRKREKQLSQTQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSPA
SSHGSTLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAA
SNSSQMGSQPPLLSRPLPLGSMPAALLTSPPTFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgccccagctcggtggtggccgcggtggcggcgccggcgggggaggcggtggctccgga
gccggggcaaccagtggaggggacgacctcggagcgaacgacgagctgatccccttccag
gacgaggggggcgaagagcaagagccgagcagcgacagcgcttcggcgcagagggatctg
gatgaggtcaagtcgtccctggtcaacgaatcggagaatcagagcagtagctcggactcc
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccgcgcgactatttc
gccgaagtgagaaggccccaggatggcgctttttttaagggacctgcgtatcctgggtac
cccttcctaatgattccagacctgagcagcccatacctctccaacggacccctgtctcct
ggtggagcgcgcacctacctacagatgaaatggcccctcctcgatgtcccctccagtgct
acagtcaaggacacaagatcgccatctccagcacacttgtatggggatcctgcccgttgg
atggtgcctcccacattcaggtccaacaaagttcctgttgtgcagcaccctcatcacatg
cacccgctgacacctctcatcacctacagcaacgaccacttctcccctgcctcccctccc
acgcatctgtccccagagatcgacccaaagacaggaatcccccggccccctcatccatct
gagctgtcaccgtattacccactgtctccaggagctgtcggacaaatccctcatcccctc
ggctggctcgtcccacagcaagggcagcccatgtactctctccctccgggtggtttccgg
catccttaccctgccctcgccatgaacgcttcaatgtctagcctggtctcaagtcggttc
ccacacatggtggctcctgcccatcctggtctgcccacctcaggaatcccgcaccctgcc
atcgtctcccccattgtgaagcaggagccagcgccccccagcctgagccctgcagtcagt
gcgaaatccccagttaccgtgaaaaaggaagaggagaagaaacctcacgtgaaaaagcct
ctgaatgccttcatgttgtatatgaaggagatgagggccaaggtggtggccgagtgtacc
ctgaaggaaagtgcagccattaaccaaatcctgggaagaaagtggcacaacctgtcaaga
gaagaacaggccaaatactatgagcttgcccggaaagaacggcagcttcacgcgcagctc
tacccaacctggtcagcccgggacaactatgggaagaagaagaagaggaagagagaaaag
cagctgtcacagacacagtctcagcagcaaatccaagaggcagagggtgctctggcctct
aagagcaagaagccatgcattcagtacctgccccctgagaagccttgtgatagccctgcg
tcttcccacggcagcacgctggactccccagcgacgccctctgcagccttggcctcacca
gcggcccctgcggctacccactccgagcaagcccagcccctgtcgctcaccaccaaaccc
gaggcccgggcccagctggctctccactccgctgccttcctgtcggctaaggccgccgcc
agcaactccagccagatgggcagccagcccccactcctgtccaggcccttgcccttgggc
tctatgcccgccgctctgctgacctctccccctactttcccagctacgctccatgcccac
caggccctccctgtgctacaggcccagcctctttccttggtcaccaagtctgcccactaa

KEGG   Mus caroli (Ryukyu mouse): 110304948
Entry
110304948         CDS       T05910                                 

Gene name
Tcf7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05132  Salmonella infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110304948 (Tcf7)
   04390 Hippo signaling pathway
    110304948 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110304948 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    110304948 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110304948 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304948 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304948 (Tcf7)
   05225 Hepatocellular carcinoma
    110304948 (Tcf7)
   05226 Gastric cancer
    110304948 (Tcf7)
   05216 Thyroid cancer
    110304948 (Tcf7)
   05221 Acute myeloid leukemia
    110304948 (Tcf7)
   05217 Basal cell carcinoma
    110304948 (Tcf7)
   05215 Prostate cancer
    110304948 (Tcf7)
   05213 Endometrial cancer
    110304948 (Tcf7)
   05224 Breast cancer
    110304948 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110304948 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304948 (Tcf7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110304948 (Tcf7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110304948 (Tcf7)
   05165 Human papillomavirus infection
    110304948 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110304948 (Tcf7)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110304948 (Tcf7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110304948
NCBI-ProteinID: XP_021032309
Ensembl: MGP_CAROLIEiJ_G0016325
UniProt: A0A6P5QMS2
LinkDB
Position
11
AA seq 485 aa
MPQLDSGGGGAGAGDDLGAPDELLAFQDEGEEQDDKNRDSAVGPERDLAELKSSLVNESE
GAAAGAGVPGPGVRVHGEAEGAPEALGREHTSQRLFPDKLPESLEDGLKAPECASGMYKE
TVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAI
VPSSGKQELQPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKES
AAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQES
TTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRCPSPVPSDDSALGCPRSPA
PQDSPSYLLLPSFPTELLASPVEPAPTFSGRSAALTLPAPKSPKTPHSTLQNPQIQQQES
QRQAA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcgcaggcgacgacctcggcgcgcct
gacgagctgctggctttccaagacgaaggcgaggaacaggacgataagaatcgcgacagt
gctgtgggccccgagcgggacctggcggagctcaagtcctcactggtgaatgagtccgaa
ggcgcggccgcaggcgctggggtcccgggtcccggcgtccgagtacatggagaagccgag
ggagcgcccgaggccctgggacgggagcacacttcgcagagacttttcccggacaaactt
ccagagtccctagaggacggcctgaaggccccggagtgtgccagtggcatgtacaaagag
actgtctactctgccttcaatctgctcatgccctacccaccggcctcgggagcagggcag
catccgcagcctcaacccccgctgcataacaagcccggccagcccccacatggcgtcccc
cagctttctccactctacgaacatttcagcagtccacaccccacccctgcaccagcggac
atcagccagaagcaaggagttcacaggccgctgcagacccccgatctctccggattttat
tctctgacctcaggcagcatgggacagctcccccatactgtgagctggttcacccaccca
tccttgatgctgggatctggtgtacctggacacccagcagccatccctcacccggccatt
gtgccctcctcagggaagcaggagctgcagccatatgatagaaacctgaaaacacaggca
gaacccaaggcggagaaggaggctaagaagccagtcatcaagaaacccctcaatgctttc
atgctttacatgaaggagatgagagccaaggtcattgccgagtgcacactcaaggagagc
gctgccatcaaccagatcctgggtcgcaggtggcatgcactatctcgagaagagcaggcc
aagtactatgaactggcccgcaaggaaaggcagctgcacatgcagctatacccaggctgg
tccgcgcgggataactacggaaagaagaagaggcggtcaagggaaaagcatcaagaatcc
accacagaccctggctcgcctaagaaatgtcgtgctcgctttggcctcaaccagcagacg
gattggtgtggtccgtgcaggaggaaaaagaaatgcattcggtacttacccggagaaggc
cgctgccccagccccgttccttccgatgacagtgctctaggctgtccccggtccccagct
ccccaggactcaccctcgtatcttctgttgccctccttccccacagaactgcttgctagc
ccagtggagccagcaccaacattctcaggtcgctctgcagctctcactcttccagcccct
aagtctccaaagaccccccacagcaccctccagaatccacagatacagcaacaagaatct
cagagacaggcagcctaa

DBGET integrated database retrieval system