KEGG   Mus caroli (Ryukyu mouse): 110285306
Entry
110285306         CDS       T05910                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110285306
   04371 Apelin signaling pathway
    110285306
   04020 Calcium signaling pathway
    110285306
   04071 Sphingolipid signaling pathway
    110285306
   04022 cGMP-PKG signaling pathway
    110285306
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110285306
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110285306
   04062 Chemokine signaling pathway
    110285306
  09152 Endocrine system
   04911 Insulin secretion
    110285306
   04922 Glucagon signaling pathway
    110285306
   04929 GnRH secretion
    110285306
   04912 GnRH signaling pathway
    110285306
   04915 Estrogen signaling pathway
    110285306
   04921 Oxytocin signaling pathway
    110285306
   04935 Growth hormone synthesis, secretion and action
    110285306
   04918 Thyroid hormone synthesis
    110285306
   04928 Parathyroid hormone synthesis, secretion and action
    110285306
   04916 Melanogenesis
    110285306
   04924 Renin secretion
    110285306
   04925 Aldosterone synthesis and secretion
    110285306
   04927 Cortisol synthesis and secretion
    110285306
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110285306
   04270 Vascular smooth muscle contraction
    110285306
  09154 Digestive system
   04970 Salivary secretion
    110285306
   04971 Gastric acid secretion
    110285306
   04972 Pancreatic secretion
    110285306
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110285306
  09156 Nervous system
   04724 Glutamatergic synapse
    110285306
   04725 Cholinergic synapse
    110285306
   04728 Dopaminergic synapse
    110285306
   04726 Serotonergic synapse
    110285306
   04720 Long-term potentiation
    110285306
   04730 Long-term depression
    110285306
   04723 Retrograde endocannabinoid signaling
    110285306
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110285306
  09159 Environmental adaptation
   04713 Circadian entrainment
    110285306
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285306
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285306
   05016 Huntington disease
    110285306
   05017 Spinocerebellar ataxia
    110285306
   05022 Pathways of neurodegeneration - multiple diseases
    110285306
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110285306
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110285306
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110285306
   05163 Human cytomegalovirus infection
    110285306
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110285306
   05142 Chagas disease
    110285306
   05143 African trypanosomiasis
    110285306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110285306
   04031 GTP-binding proteins [BR:mcal04031]
    110285306
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110285306
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110285306
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 110285306
NCBI-ProteinID: XP_021007027
Ensembl: MGP_CAROLIEiJ_G0022795
UniProt: A0A6P5P3P1
LinkDB
Position
19
AA seq 301 aa
MRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDV
EKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQD
VLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQV
LVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGP
QRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaggatcatccatgggtcgggctactctgatgaagacaagcgcggcttcaccaagctg
gtgtatcagaacatcttcacggccatgcaggccatgatcagagcgatggacacgctcaag
atcccatacaagtatgaacacaataaggctcatgcacaattggttcgagaggttgatgtg
gagaaggtgtctgcttttgagaatccatatgtagatgcaataaagagcttgtggaatgat
cctggaatccaggagtgctacgacagacgacgggaatatcagttatctgactctaccaaa
tactatctgaatgacttggaccgtgtagccgacccttcctatctgcctacacaacaagac
gtgcttagagttcgagtccccactacagggatcatcgaatacccctttgacttacaaagt
gtcattttcagaatggtcgatgtagggggccaaagatcagagagaagaaaatggatacac
tgctttgaaaatgtcacctccatcatgtttctagtagcgcttagcgaatatgatcaagtt
cttgtggagtcagacaatgagaaccgaatggaggagagcaaagcactctttagaacaatt
atcacctacccctggttccagaactcctctgtgattctgttcctaaacaagaaagatctt
ctagaggagaaaatcatgtactcccacctagtcgactacttcccagaatatgatggaccc
cagagagatgcccaggctgctcgagaattcatcctgaagatgttcgtggacctgaacccc
gacagtgacaaaatcatctactcccacttcacgtgtgccacagacaccgagaacatccgc
ttcgtctttgcagccgtcaaggacaccatcctgcagctgaacctgaaggagtacaatctg
gtctaa

KEGG   Mus caroli (Ryukyu mouse): 110303103
Entry
110303103         CDS       T05910                                 

Gene name
Gna11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04540  Gap junction
mcal04725  Cholinergic synapse
mcal04730  Long-term depression
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110303103 (Gna11)
   04022 cGMP-PKG signaling pathway
    110303103 (Gna11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110303103 (Gna11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110303103 (Gna11)
   04929 GnRH secretion
    110303103 (Gna11)
   04912 GnRH signaling pathway
    110303103 (Gna11)
   04935 Growth hormone synthesis, secretion and action
    110303103 (Gna11)
   04928 Parathyroid hormone synthesis, secretion and action
    110303103 (Gna11)
   04925 Aldosterone synthesis and secretion
    110303103 (Gna11)
   04927 Cortisol synthesis and secretion
    110303103 (Gna11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110303103 (Gna11)
  09156 Nervous system
   04725 Cholinergic synapse
    110303103 (Gna11)
   04730 Long-term depression
    110303103 (Gna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303103 (Gna11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110303103 (Gna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110303103 (Gna11)
   05163 Human cytomegalovirus infection
    110303103 (Gna11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110303103 (Gna11)
   05142 Chagas disease
    110303103 (Gna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110303103 (Gna11)
   04031 GTP-binding proteins [BR:mcal04031]
    110303103 (Gna11)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110303103 (Gna11)
  Exosomal proteins of melanoma cells
   110303103 (Gna11)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110303103 (Gna11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 110303103
NCBI-ProteinID: XP_021029698
Ensembl: MGP_CAROLIEiJ_G0015647
UniProt: A0A6P5QA52
LinkDB
Position
10
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgacgaggtgaaggagtcgaagcgc
atcaacgcggagatcgagaaacagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctacttggcactggcgagagcgggaagagtaccttcatcaagcagatgcgc
atcatccacggggccggctactcggaggaggacaagcgcggcttcacaaagttggtgtac
cagaacatcttcaccgccatgcaggccatggtgcgcgccatggagacgctcaagatcctc
tacaagtatgagcaaaacaaggccaatgcactcctgatccgggaggtcgatgtggagaag
gtcacgacttttgagcaccagtatgtgaacgccatcaagacgctgtggagtgaccctggt
gtccaggagtgttacgatcgcaggcgggagttccagctatctgactcggctaagtactac
ttgacggacgtggaccgcatcgccacagtaggctacctgcccacccagcaggatgtgctg
cgggtccgcgtgcccaccactggcatcatcgagtacccgtttgacctggagaacatcatc
ttcaggatggtggatgtgggcgggcagaggtcagagcgcaggaagtggatccattgcttt
gagaacgtgacttccatcatgttcttggtggcactaagcgagtatgaccaagtcctggtg
gagtcagacaatgagaaccgcatggaggagagcaaggccctgttccgcacaatcatcacc
tacccctggttccagaactcgtctgtcattctcttcctcaacaagaaggaccttctagaa
gacaagatcctgcactcacacttggtcgattacttccctgagtttgatgggccacagagg
gatgcacaggccgcacgcgagttcattctgaagatgtttgtggacctgaaccctgacagc
gacaagatcatctactcccacttcacgtgtgccaccgacaccgagaacatccgctttgtg
ttcgcagctgtgaaggacaccatcctgcagctgaacctgaaggagtacaacctggtgtga

DBGET integrated database retrieval system