KEGG   Mus caroli (Ryukyu mouse): 110285320
Entry
110285320         CDS       T05910                                 

Gene name
Plcb3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04062  Chemokine signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04621  NOD-like receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110285320 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110285320 (Plcb3)
   04310 Wnt signaling pathway
    110285320 (Plcb3)
   04371 Apelin signaling pathway
    110285320 (Plcb3)
   04020 Calcium signaling pathway
    110285320 (Plcb3)
   04070 Phosphatidylinositol signaling system
    110285320 (Plcb3)
   04072 Phospholipase D signaling pathway
    110285320 (Plcb3)
   04071 Sphingolipid signaling pathway
    110285320 (Plcb3)
   04022 cGMP-PKG signaling pathway
    110285320 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110285320 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110285320 (Plcb3)
   04613 Neutrophil extracellular trap formation
    110285320 (Plcb3)
   04621 NOD-like receptor signaling pathway
    110285320 (Plcb3)
   04062 Chemokine signaling pathway
    110285320 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    110285320 (Plcb3)
   04922 Glucagon signaling pathway
    110285320 (Plcb3)
   04929 GnRH secretion
    110285320 (Plcb3)
   04912 GnRH signaling pathway
    110285320 (Plcb3)
   04915 Estrogen signaling pathway
    110285320 (Plcb3)
   04921 Oxytocin signaling pathway
    110285320 (Plcb3)
   04926 Relaxin signaling pathway
    110285320 (Plcb3)
   04935 Growth hormone synthesis, secretion and action
    110285320 (Plcb3)
   04918 Thyroid hormone synthesis
    110285320 (Plcb3)
   04919 Thyroid hormone signaling pathway
    110285320 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    110285320 (Plcb3)
   04916 Melanogenesis
    110285320 (Plcb3)
   04924 Renin secretion
    110285320 (Plcb3)
   04925 Aldosterone synthesis and secretion
    110285320 (Plcb3)
   04927 Cortisol synthesis and secretion
    110285320 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110285320 (Plcb3)
   04270 Vascular smooth muscle contraction
    110285320 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    110285320 (Plcb3)
   04971 Gastric acid secretion
    110285320 (Plcb3)
   04972 Pancreatic secretion
    110285320 (Plcb3)
   04973 Carbohydrate digestion and absorption
    110285320 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110285320 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110285320 (Plcb3)
   04725 Cholinergic synapse
    110285320 (Plcb3)
   04728 Dopaminergic synapse
    110285320 (Plcb3)
   04726 Serotonergic synapse
    110285320 (Plcb3)
   04720 Long-term potentiation
    110285320 (Plcb3)
   04730 Long-term depression
    110285320 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    110285320 (Plcb3)
  09157 Sensory system
   04742 Taste transduction
    110285320 (Plcb3)
   04750 Inflammatory mediator regulation of TRP channels
    110285320 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110285320 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285320 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285320 (Plcb3)
   05016 Huntington disease
    110285320 (Plcb3)
   05017 Spinocerebellar ataxia
    110285320 (Plcb3)
   05022 Pathways of neurodegeneration - multiple diseases
    110285320 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110285320 (Plcb3)
   04934 Cushing syndrome
    110285320 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110285320 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110285320 (Plcb3)
   05142 Chagas disease
    110285320 (Plcb3)
   05143 African trypanosomiasis
    110285320 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110285320 (Plcb3)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110285320 (Plcb3)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110285320 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110285320 (Plcb3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 110285320
NCBI-ProteinID: XP_021007055
Ensembl: MGP_CAROLIEiJ_G0022621
UniProt: A0A6P5NV22
LinkDB
Position
19
AA seq 1234 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKMREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYETNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGPSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAEAAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLSAGTPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKASLEPQKSLGE
ESLSREPNVPMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDKKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWEEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTETYQETPCQQ
PGSQLPSNPTPNPLDASPRWPPGPTTSPTSSSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSPSALGKATNTE
DAKEEEEAKQYREFQNRQVQSLLELREAQADVETKRKLEHLRQAHQRLKEVVLDTHTTQF
KRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRRLE
EAQKQRHERLVAGQQQVLQQLEDEEPKLLAQLTQECQEQRERLPQEIRRCLLGETSEGLG
DGPLVACASNGHAPGSGGHLSSADSESQEENTQL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccctaagatgcgagaagtactgggctttgggggtcctgacacccggctggag
gagaaactgatgacagtggtggccgggccagatccagtaaataccacgttcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaaactggctatg
aacatattggctcagaacgcctcccggaacaccttcctgcggaaagcatacacgaagctg
aagctgcaggtgaatcaggatggacggattccggtcaagaacattctgaagatgttctca
gcggacaagaagcgggtggagacggcgctggagtcctgtggcctcaacttcaaccgaagt
gagtccattcgtcctgatgagttttccttggaaatctttgagcggttcttgaacaaactg
tgtctgcgcccggatattgacaagatcctgctggagataggtgccaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcagagagacccgagactcaac
gaagtgctgtacccgccactccggtcctcacaggctcggctactcattgagaagtacgag
acgaacaaacagttcctggagcgcgaccagatgtctatggagggcttcagccgctacctg
ggaggggaggagaacggtatcctgcctctggaggccctggatctgagcatggacatgacc
cagccactgagcgcatacttcatcaactcctcgcacaatacctatctcactgcgggccag
ctggctggaccatcatcggtggagatgtaccgccaggcactgctgtggggctgccgctgt
gtggagctggatgtatggaagggacggccaccggaggaagaacctttcatcactcatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgctagaggccatcgctgaggcagcc
ttcaagacctcgccctaccctgtcatcctctcctttgagaaccatgtcgactcggcaaag
cagcaggccaagatggctgagtactgccgctctatctttggagatgcgctgctcattgac
cctctcgacaaatacccgctatctgcgggcacccccttgccaagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcggcatcggcccagcacaggcgtccctgacagc
tcagtgcgcaagcggcctctggaacagagcaactcggccttgagtgagagctcggccgcc
acagagccctcctcacctcagcttgggtcccccagctccgacagctgccctggcctaagc
aatggggaggaggtgggactcgagaaggccagcctggagcctcagaagtctctaggtgag
gagagcctcagtcgggaacctaatgtgcccatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaagaggaaacaacggatccaaaaaagcctaccactgatgagggcaca
gccagcagtgaggtcaatgccacggaggagatgtcaacgctcgtcaactacgttgagccc
gtcaagttcaagtcctttgaggctgcacgaaaaaggaacaagtgcttcgagatgtcatcc
ttcgtggagaccaaggcaatggagcaactgaccaagagtcctatggagtttgtggaatac
aacaaacagcagctcagccgcatctaccccaagggcacacgagtggactcctccaactac
atgcctcagctcttctggaacgtgggttgccagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaatgggcgcagcggatacttg
ctcaagcctgagtttatgcggcggccggacaagtcttttgaccccttcactgaggtcatc
gtcgatggcatagtggccaacgccttgcgggtcaaggtgatttcagggcagttcctgtct
gacaagaaggtgggcatctacgttgaggtggacatgtttggtctcccagttgacacaaga
cgcaaatatcgtacccggacatcacaggggaactcattcaaccctgtgtgggaagaggaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcactacgcattgcagccttt
gaggagggtggcaaatttgttgggcaccgtatcctgcctgtctctgctatccgctcagga
taccactatgtctgcctgcgaaatgaggccaaccaacctttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
attaaccccatcaagcatgtaagcctaatggaccagcgggccaagcaactggctgctctc
attggggagagtgaggctcaggccagcacagagacatatcaggagactccgtgtcaacag
ccagggtcacagctcccctccaaccccacacctaacccactggatgcctcgcctcgctgg
ccccccggtcctaccacttcccccactagttcctccctcagtagcccagggcagcgagat
gatttgattgccagcatcctctctgaggtgacccctacacctctagaggagctccgaagc
cacaaggctatggtgaagctacggagccggcaggatcgagacctgcgggagttgcataag
aagcaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcccccagtgccctgggcaaggccaccaacacggag
gacgcgaaggaggaagaggaggccaaacagtatcgagagttccagaaccgacaagtacag
agcctgctggagctgagggaagcccaggcagatgtggagaccaagcggaagctggaacat
ctacgacaggctcatcagcggctcaaggaggttgtcctggatacacacacaactcagttc
aagaggctgaaggagctgaatgaaagggagaagaaggaactccagaagatcctggacagg
aagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggaggtggaa
ctgacggagattaatcggcggcacatcactgagtcggtaaactccatcagacggctggaa
gaggcccagaagcagcgccatgagcgcctggtggcagggcagcagcaagtcctccagcag
ctggaggacgaggaacccaagctgctggcccagctgacccaggagtgtcaggaacagcga
gagaggttgccccaggagatccgtcggtgcctgctgggcgagacatcagagggattgggg
gacggccccctggtggcctgtgccagcaatggtcatgcacctgggagtggtgggcacctg
tccagcgctgactcggagagccaggaggagaacacccagctttga

KEGG   Mus caroli (Ryukyu mouse): 110286326
Entry
110286326         CDS       T05910                                 

Gene name
Plcb2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04062  Chemokine signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04621  NOD-like receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110286326 (Plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110286326 (Plcb2)
   04310 Wnt signaling pathway
    110286326 (Plcb2)
   04371 Apelin signaling pathway
    110286326 (Plcb2)
   04020 Calcium signaling pathway
    110286326 (Plcb2)
   04070 Phosphatidylinositol signaling system
    110286326 (Plcb2)
   04072 Phospholipase D signaling pathway
    110286326 (Plcb2)
   04071 Sphingolipid signaling pathway
    110286326 (Plcb2)
   04022 cGMP-PKG signaling pathway
    110286326 (Plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110286326 (Plcb2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110286326 (Plcb2)
   04613 Neutrophil extracellular trap formation
    110286326 (Plcb2)
   04621 NOD-like receptor signaling pathway
    110286326 (Plcb2)
   04062 Chemokine signaling pathway
    110286326 (Plcb2)
  09152 Endocrine system
   04911 Insulin secretion
    110286326 (Plcb2)
   04922 Glucagon signaling pathway
    110286326 (Plcb2)
   04929 GnRH secretion
    110286326 (Plcb2)
   04912 GnRH signaling pathway
    110286326 (Plcb2)
   04915 Estrogen signaling pathway
    110286326 (Plcb2)
   04921 Oxytocin signaling pathway
    110286326 (Plcb2)
   04926 Relaxin signaling pathway
    110286326 (Plcb2)
   04935 Growth hormone synthesis, secretion and action
    110286326 (Plcb2)
   04918 Thyroid hormone synthesis
    110286326 (Plcb2)
   04919 Thyroid hormone signaling pathway
    110286326 (Plcb2)
   04928 Parathyroid hormone synthesis, secretion and action
    110286326 (Plcb2)
   04916 Melanogenesis
    110286326 (Plcb2)
   04924 Renin secretion
    110286326 (Plcb2)
   04925 Aldosterone synthesis and secretion
    110286326 (Plcb2)
   04927 Cortisol synthesis and secretion
    110286326 (Plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110286326 (Plcb2)
   04270 Vascular smooth muscle contraction
    110286326 (Plcb2)
  09154 Digestive system
   04970 Salivary secretion
    110286326 (Plcb2)
   04971 Gastric acid secretion
    110286326 (Plcb2)
   04972 Pancreatic secretion
    110286326 (Plcb2)
   04973 Carbohydrate digestion and absorption
    110286326 (Plcb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110286326 (Plcb2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110286326 (Plcb2)
   04725 Cholinergic synapse
    110286326 (Plcb2)
   04728 Dopaminergic synapse
    110286326 (Plcb2)
   04726 Serotonergic synapse
    110286326 (Plcb2)
   04720 Long-term potentiation
    110286326 (Plcb2)
   04730 Long-term depression
    110286326 (Plcb2)
   04723 Retrograde endocannabinoid signaling
    110286326 (Plcb2)
  09157 Sensory system
   04742 Taste transduction
    110286326 (Plcb2)
   04750 Inflammatory mediator regulation of TRP channels
    110286326 (Plcb2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110286326 (Plcb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286326 (Plcb2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110286326 (Plcb2)
   05016 Huntington disease
    110286326 (Plcb2)
   05017 Spinocerebellar ataxia
    110286326 (Plcb2)
   05022 Pathways of neurodegeneration - multiple diseases
    110286326 (Plcb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110286326 (Plcb2)
   04934 Cushing syndrome
    110286326 (Plcb2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110286326 (Plcb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110286326 (Plcb2)
   05142 Chagas disease
    110286326 (Plcb2)
   05143 African trypanosomiasis
    110286326 (Plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110286326 (Plcb2)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110286326 (Plcb2)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110286326 (Plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110286326 (Plcb2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2
Other DBs
NCBI-GeneID: 110286326
NCBI-ProteinID: XP_021008394
Ensembl: MGP_CAROLIEiJ_G0024121
UniProt: A0A6P5P1C5
LinkDB
Position
2
AA seq 1181 aa
MSLLNPVLLPPNVKAYLSQGERFIKWDDETSIASPVILRVDPKGYYLYWTNQNQEMEFLD
VTSIRDTRFGKFAKIPKSQKLREVFNMDFPDNNFLLKTLTVVSGPDMVDLTFYNFVSYKE
NVGKDWAEDVLALAKHPMTANAPRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALGACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPAQPEQVQVLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAHDTLLIHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDILFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGETLLTDPLENFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASSSKKPGGV
AEGSLPSSVPVEEDTGWTAEDRTEVEEEELVEEEEEEESGSLDEEEIKKMQSDEGTAGLE
VTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVVSSFTELKACELLSKASMQFVDYNKRQ
MSRVYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHE
FMRRRDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYR
TKLSPTANSINPVWKEEPFIFEKILMPELASLRIAVMEEGSKFLGHRIIPINALHSGYHH
LCLRSESNMPLTMPALFVFLEMKDYIPDTWADLTVALANPIKYFNAQDKKSVKLKEMTGS
LPEKLFSGTPVASQSNGAPVSAGNGSAAPGTKATGDEATKEVTEPQTASLEELQELKGVV
KLQRRHEKELRELERRGARRWEELLQRGAAQLAELQTPAAGSKLRPGKGSRKKRTLPCEE
TVVAPSEPHDRADPRVQELKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAKEK
QAAELKTFKETSEIDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQEVV
QAVKQMTETLERHQEKLEERQTACLEQIQAMEKQFQEKALAEYEAKMKGLEAEVKESVRA
YFKVCFPAEAEDKPERFCEASEESCPQEPLVSKADIQESRL
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgtctttgctcaaccctgtcctgttgccccctaacgtgaaggcatatctgagccaaggg
gagcgcttcatcaagtgggacgatgaaacttcaatagcctctcctgttatcctccgtgtg
gatcccaagggctattacttatactggacaaatcaaaatcaggagatggagttcctggat
gtcacgagcatccgagatactcgctttgggaagtttgcaaagatacccaagagccagaaa
ctccgggaggtcttcaacatggacttcccagacaacaacttcctgctgaaaacactcaca
gtggtatccggccctgacatggtggacctcaccttctacaactttgtctcttacaaggag
aacgtaggcaaggactgggctgaggacgtgctagctctcgccaaacaccccatgacagcc
aatgctcctcgaagcacattcctggacaagatcctggtgaagcttaagatgcagctcaac
cctgaagggaagattcctgtgaagaattttttccagatgtttcctgctgatcgcaaacgg
gtggaagctgccctcggtgcttgtcaccttgcaaaaggcaaaaatgatgctatcaaccca
gaggacttcccagaatccgtgtacaagagcttcctcatgagcctctgtcctcggccagaa
atcgacgagatcttcacttcctaccacgctaaagctaagccctacatgaccaaggagcac
ctgaccaaattcatcaatcagaagcagcgagaccctcgactcaactctttgctgttccca
ccggcccagcctgagcaagttcaagtgctcattgacaaatacgaacccagcggcatcaat
gtgcagaggggccagctgtcgccagaggggatggtctggtttctctgtggaccagagaac
agtgtgctggcccacgatacactgctgatccaccaagacatgacacaaccactgaatcac
tatttcatcaactcctcacacaacacctacctgacagccggccagttctcaggcctttcc
tcggctgagatgtaccgccaggtgctgctgtctggctgccgttgtgtagagttagactgt
tggaagggcaagccccccgatgaagagcccattatcacccacggcttcaccatgaccaca
gatatcttgttcaaggaagcaatcgaagccattgcagaaagtgcctttaagacctccccg
tatcctgtcatcctgtcatttgaaaaccatgtagactcaccccgccaacaggctaagatg
gctgagtactgcaggaccatgtttggagagaccttgctcacagatcccctggaaaatttt
cctctgaaacctggcatccctctgcccagccccgaggacctccggggcaagatcctcatt
aagaataagaagaaccagttttctgggccagcatcctccagcaagaagcctggtggggtg
gctgagggcagcctcccgtctagtgtccctgtagaagaggacacggggtggactgctgag
gaccggactgaggtggaggaggaggagttggtggaagaggaggaagaggaggagtcagga
agcctggatgaagaagaaattaagaagatgcagtcggatgagggcacagcaggcctggag
gtgacagcttatgaggaaatgtccagccttgtcaattatatccagcccaccaagtttatc
tccttcgagttctctgcacagaagaacagaagttacgttgtctcttccttcacggagctc
aaggcctgcgagctgctctccaaggcctccatgcagtttgtggactataataaacgccag
atgagtcgtgtgtaccccaagggcacacgcatggactcttccaactacatgccccagatg
ttctggaatgctggatgtcagatggttgccctcaatttccagacaatggacctgcccatg
cagcagaacatggcactgtttgagttcaacgggcagagtggctacctcctaaagcatgag
ttcatgcgcagacgggacaagcagttcaaccccttctcagtggaccgcattgatgtggtg
gtagccaccaccctttccattacggtcatctctgggcagttcctgtcagagcgcagtgta
cgcacctatgtggaagtggaactgtttggcctcccaggggaccccaagaggcgatatcga
accaagctgtcacctactgctaactccatcaatcctgtctggaaagaggaaccctttatc
tttgagaagatcttgatgcctgagctggcctccctcaggatagctgtgatggaagaaggc
agcaaatttcttggacaccgcatcatccccatcaatgccttacattctggataccaccat
ctgtgcctgcgcagtgagagcaacatgccccttaccatgccagctctctttgtcttcctg
gagatgaaggactacatacctgacacgtgggcagatcttacggtggcccttgccaacccc
atcaagtacttcaatgcccaggataagaagtccgtgaagctcaaagaaatgacaggaagt
ctgcccgagaaactcttctctgggacacctgttgccagtcagtccaatggggcgccagtc
tcagcaggcaatgggtcagcagcgcctgggaccaaggccacgggggacgaagctacgaaa
gaagtgacagagccacagaccgccagcttggaagagttgcaggaactgaagggcgtggtg
aagctgcagcgaagacatgagaaggagcttcgagagctggagcgccgtggagcccggcgc
tgggaggaactgctgcagcgtggcgccgcacagctggcggagctccagaccccggcagca
ggcagcaaactccgcccgggcaagggctcccgcaagaagaggaccctgccctgtgaggag
accgtcgtggcgcctagcgagccccacgaccgggcggacccgcgcgtgcaggagctgaag
gacaggctggagcaggagctgcagcagcaaggcgaggagcagtaccgctctgtcctcaag
cgcaaggagcagcatgtgactgagcaaatcgccaagatgatggagctggccaaagagaaa
caggctgctgaactcaagaccttcaaggaaacctcagaaattgataccaaagaaatgaag
aaaaagctggaggccaagaggctggaacggatccaagccatgaccaaggtcaccacagac
aaggtggcccaggagaggctcaagagagaaattaacaactcccacatccaggaagtggtc
caggctgtcaagcagatgacagagaccctggagcgtcaccaagagaagctggaagagagg
cagacagcctgcctggagcagatccaggcaatggaaaagcagttccaggagaaggcgcta
gcagagtatgaggccaagatgaagggcctggaggctgaagtaaaggagtcggtgcgggcc
tacttcaaggtctgcttccccgctgaagcagaagacaagcctgagaggttctgtgaggcc
tctgaggagtcgtgtccacaggaaccacttgtgagcaaggcagacatccaggagagccgc
ctctga

KEGG   Mus caroli (Ryukyu mouse): 110290514
Entry
110290514         CDS       T05910                                 

Gene name
Plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04062  Chemokine signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04621  NOD-like receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110290514 (Plcb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110290514 (Plcb4)
   04310 Wnt signaling pathway
    110290514 (Plcb4)
   04371 Apelin signaling pathway
    110290514 (Plcb4)
   04020 Calcium signaling pathway
    110290514 (Plcb4)
   04070 Phosphatidylinositol signaling system
    110290514 (Plcb4)
   04072 Phospholipase D signaling pathway
    110290514 (Plcb4)
   04071 Sphingolipid signaling pathway
    110290514 (Plcb4)
   04022 cGMP-PKG signaling pathway
    110290514 (Plcb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110290514 (Plcb4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110290514 (Plcb4)
   04613 Neutrophil extracellular trap formation
    110290514 (Plcb4)
   04621 NOD-like receptor signaling pathway
    110290514 (Plcb4)
   04062 Chemokine signaling pathway
    110290514 (Plcb4)
  09152 Endocrine system
   04911 Insulin secretion
    110290514 (Plcb4)
   04922 Glucagon signaling pathway
    110290514 (Plcb4)
   04929 GnRH secretion
    110290514 (Plcb4)
   04912 GnRH signaling pathway
    110290514 (Plcb4)
   04915 Estrogen signaling pathway
    110290514 (Plcb4)
   04921 Oxytocin signaling pathway
    110290514 (Plcb4)
   04926 Relaxin signaling pathway
    110290514 (Plcb4)
   04935 Growth hormone synthesis, secretion and action
    110290514 (Plcb4)
   04918 Thyroid hormone synthesis
    110290514 (Plcb4)
   04919 Thyroid hormone signaling pathway
    110290514 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    110290514 (Plcb4)
   04916 Melanogenesis
    110290514 (Plcb4)
   04924 Renin secretion
    110290514 (Plcb4)
   04925 Aldosterone synthesis and secretion
    110290514 (Plcb4)
   04927 Cortisol synthesis and secretion
    110290514 (Plcb4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110290514 (Plcb4)
   04270 Vascular smooth muscle contraction
    110290514 (Plcb4)
  09154 Digestive system
   04970 Salivary secretion
    110290514 (Plcb4)
   04971 Gastric acid secretion
    110290514 (Plcb4)
   04972 Pancreatic secretion
    110290514 (Plcb4)
   04973 Carbohydrate digestion and absorption
    110290514 (Plcb4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110290514 (Plcb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    110290514 (Plcb4)
   04725 Cholinergic synapse
    110290514 (Plcb4)
   04728 Dopaminergic synapse
    110290514 (Plcb4)
   04726 Serotonergic synapse
    110290514 (Plcb4)
   04720 Long-term potentiation
    110290514 (Plcb4)
   04730 Long-term depression
    110290514 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    110290514 (Plcb4)
  09157 Sensory system
   04742 Taste transduction
    110290514 (Plcb4)
   04750 Inflammatory mediator regulation of TRP channels
    110290514 (Plcb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110290514 (Plcb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290514 (Plcb4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110290514 (Plcb4)
   05016 Huntington disease
    110290514 (Plcb4)
   05017 Spinocerebellar ataxia
    110290514 (Plcb4)
   05022 Pathways of neurodegeneration - multiple diseases
    110290514 (Plcb4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110290514 (Plcb4)
   04934 Cushing syndrome
    110290514 (Plcb4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110290514 (Plcb4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110290514 (Plcb4)
   05142 Chagas disease
    110290514 (Plcb4)
   05143 African trypanosomiasis
    110290514 (Plcb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110290514 (Plcb4)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110290514 (Plcb4)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110290514 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110290514 (Plcb4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Other DBs
NCBI-GeneID: 110290514
NCBI-ProteinID: XP_021012729
Ensembl: MGP_CAROLIEiJ_G0024353
LinkDB
Position
2
AA seq 1187 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESADQEEEAHPEYKFGNELSADDYSHKEAVANSVKKTSD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQ
SSSELRPTTTAALGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagtgccctctttcttgcaagaagga
gcagtttttgacagatacgaagaggaatcttttgtctttgagcccaactgcctcttcaaa
gtggatgaattcggcttcttcctgacgtggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtattcgccaggcagccataccaaaggatcccaaaatcctg
gctgctctcgaagctgttggaaaatctgaaaatgatctggaaggacggatattgtgtgtc
tgcagcggcacggatctggtgaatatcggcttcacttacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaagcactggatgaaactggcctttctgaccaacaca
actggtaaaatcccagtgaggagtatcactagaacctttgcatcgggtaaaacagaaaag
gtgatctttcaagccctcaaggaattaggtcttcccagtggaaagaatgatgaaattgag
cctgctgcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccattttatgatgctaaaagagcaatgcagatcattgagatgtatgagcctgatgaagag
ctgaagaaaaaaggcctcatatccagtgatggattctgcagatatctgatgtcagatgaa
aatgcccccgtcttcctagatcgcttagaactttaccaggagatggaccacccgctggct
cattacttcatcagttcctcccacaacacctatctcaccggccggcaatttggaggaaag
tcttcagtggaaatgtacagacaagttctcctggctggttgcaggtgtgttgaacttgac
tgttgggatggaaaaggtgaagatcaggaaccgataataactcacggaaaagcaatgtgc
acagacatcctttttaaggatgtaatccaggccatcaaggaaacggcgtttgtcacatca
gaataccctgtcattctctccttcgaaaaccactgcagcaaatatcaacagtacaagatg
tccaagtattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcgcat
ccacttgaaccaggaaggcccttgccgtctcctaatgacctcaaaagaaaaatactcatc
aagaataagaggctgaagcctgaagttgaaaagaaacagcttgaagctttgaaaagcatg
atggaagctggagagtcagcggccccggctagcatcttggaagacgacaatgaagaggaa
atagaaagtgctgatcaagaggaagaagcccaccctgaatacaaatttggaaacgaactt
tctgccgatgactacagtcacaaggaagcggttgcaaacagcgtcaagaagacctcagat
gaccttgaacatgaaaacaacaaaaagggcctggtcaccgtagaggatgagcaagcatgg
atggcatcttataaatacgtaggtgctaccacgaacatccatccgtacttgtccacgatg
atcaactatgcccagcccgtgaagtttcaaggtttccacgtggctgaagagcgcaatatt
cactataacatgtcttcttttaacgagtcggttggccttggctacttgaagacgcacgcg
attgagtttgtaaattacaataagcgacaaatgagccgcatttaccccaagggcggccgc
gtggattccagtaattacatgcctcagattttctggaacgctggttgccagatggtttca
ctgaactatcaaaccccagatttagcaatgcaattgaatcaaggaaaatttgagtataat
ggatcgtgcgggtaccttctcaagccagatttcatgaggcgacctgatcggacatttgac
cccttctctgaaaccccagtggacggggttattgcagccacgtgctcagtgcaggttata
tcagggcagttcctctcagataagaagatcgggacgtatgtggaagtcgatatgtacggg
ctgcccaccgacaccatacggaaagagttccgaacccgcatggttatgaacaatggactc
aacccagtgtataatgaagaatcgtttgtgtttcgaaaggtgatcctgcctgacctagct
gtcctgagaatcgcagtctatgatgataacaacaagctgattggccagaggatccttcct
ttggatggtctccaagcaggctaccgacacatctccctgagaaatgagggaaacaaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatccgatccaaagaaatttctttcaatcacagagaagaga
gcagaccaaatgagagcaatgggcattgaaactagtgacatagctgatgtgcccagtgac
acttccaaaaatgacaagaaaggcaaggccaacccagccaaagcaaacgtgacccctcag
agcagctctgagctcagaccaaccaccacagccgccctgggctctggccaggaagccaag
aaaggtattgaacttatccctcaagtgaggatagaagatttaaagcaaatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaactctttaaagaagaaacatgcaaag
gagcacagcaccatgcagaagttacactgcacacaagttgacaaaatcgtggcccagtat
gacaaagagaagtcgactcatgagaaaatcctagagaaggcgatgaagaagaagggggga
agtaattgtcttgaaataaaaaaagaaacagaaattaaaattcagaccctgacaacggat
cacaaatctaaggtcaaagagattgtggcccagcacacaaaggagtggtcagaaatgatc
aacactcacagtgcggaggagcaggaaatccgagatctgcacctgagccagcagtgtgag
ctgctgagaaaactgctcatcaatgctcatgagcagcagacccagcagctgaaactctcc
catgacagggaaagcaaggagatgagagcccatcaggctaagatttctatggaaaatagc
aaggccatcagtcaagataaatctatcaagaataaggcagaacgggaaaggcgagttagg
gagttgaacagcagcaacactaagaagttcctagaagaaagaaagagactggcaatgaag
cagtcaaaagaaatggatcagttgaaaaaagtccagctggagcacctagagttcctagag
aaacagaacgagcaggcgaaggagatgcagcagatggtgaaattggaagccgagatggac
cgcagaccagcaacagtagtatga

KEGG   Mus caroli (Ryukyu mouse): 110308867
Entry
110308867         CDS       T05910                                 

Gene name
Plcb1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04062  Chemokine signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04621  NOD-like receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110308867 (Plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110308867 (Plcb1)
   04310 Wnt signaling pathway
    110308867 (Plcb1)
   04371 Apelin signaling pathway
    110308867 (Plcb1)
   04020 Calcium signaling pathway
    110308867 (Plcb1)
   04070 Phosphatidylinositol signaling system
    110308867 (Plcb1)
   04072 Phospholipase D signaling pathway
    110308867 (Plcb1)
   04071 Sphingolipid signaling pathway
    110308867 (Plcb1)
   04022 cGMP-PKG signaling pathway
    110308867 (Plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110308867 (Plcb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110308867 (Plcb1)
   04613 Neutrophil extracellular trap formation
    110308867 (Plcb1)
   04621 NOD-like receptor signaling pathway
    110308867 (Plcb1)
   04062 Chemokine signaling pathway
    110308867 (Plcb1)
  09152 Endocrine system
   04911 Insulin secretion
    110308867 (Plcb1)
   04922 Glucagon signaling pathway
    110308867 (Plcb1)
   04929 GnRH secretion
    110308867 (Plcb1)
   04912 GnRH signaling pathway
    110308867 (Plcb1)
   04915 Estrogen signaling pathway
    110308867 (Plcb1)
   04921 Oxytocin signaling pathway
    110308867 (Plcb1)
   04926 Relaxin signaling pathway
    110308867 (Plcb1)
   04935 Growth hormone synthesis, secretion and action
    110308867 (Plcb1)
   04918 Thyroid hormone synthesis
    110308867 (Plcb1)
   04919 Thyroid hormone signaling pathway
    110308867 (Plcb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110308867 (Plcb1)
   04916 Melanogenesis
    110308867 (Plcb1)
   04924 Renin secretion
    110308867 (Plcb1)
   04925 Aldosterone synthesis and secretion
    110308867 (Plcb1)
   04927 Cortisol synthesis and secretion
    110308867 (Plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110308867 (Plcb1)
   04270 Vascular smooth muscle contraction
    110308867 (Plcb1)
  09154 Digestive system
   04970 Salivary secretion
    110308867 (Plcb1)
   04971 Gastric acid secretion
    110308867 (Plcb1)
   04972 Pancreatic secretion
    110308867 (Plcb1)
   04973 Carbohydrate digestion and absorption
    110308867 (Plcb1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110308867 (Plcb1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110308867 (Plcb1)
   04725 Cholinergic synapse
    110308867 (Plcb1)
   04728 Dopaminergic synapse
    110308867 (Plcb1)
   04726 Serotonergic synapse
    110308867 (Plcb1)
   04720 Long-term potentiation
    110308867 (Plcb1)
   04730 Long-term depression
    110308867 (Plcb1)
   04723 Retrograde endocannabinoid signaling
    110308867 (Plcb1)
  09157 Sensory system
   04742 Taste transduction
    110308867 (Plcb1)
   04750 Inflammatory mediator regulation of TRP channels
    110308867 (Plcb1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110308867 (Plcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308867 (Plcb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110308867 (Plcb1)
   05016 Huntington disease
    110308867 (Plcb1)
   05017 Spinocerebellar ataxia
    110308867 (Plcb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110308867 (Plcb1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110308867 (Plcb1)
   04934 Cushing syndrome
    110308867 (Plcb1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110308867 (Plcb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110308867 (Plcb1)
   05142 Chagas disease
    110308867 (Plcb1)
   05143 African trypanosomiasis
    110308867 (Plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110308867 (Plcb1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110308867 (Plcb1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110308867 (Plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110308867 (Plcb1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 110308867
NCBI-ProteinID: XP_021036850
Ensembl: MGP_CAROLIEiJ_G0024352
UniProt: A0A6P5QRM0
LinkDB
Position
2
AA seq 1173 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKP
KGEGSSSVLSEGCHEDPSVPPNFTPPNPQALKW
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggctggggctcagcccggagtgcacgccttgcaactcaagcccgtgtgcgtgtctgac
agcctcaaaaagggcaccaaattcgtcaaatgggatgatgactccactattgttactcca
attattttgaggactgatcctcagggatttttcttttactggacagaccagaataaggag
acggagctgttagatctcagccttgtcaaggatgccaggtgtgggaagcacgccaaagct
cccaaggaccccaagttgcgtgaacttctggatgttgggaacatcggacacttggaacag
cgcatgataactgtggtgtatggaccagacctggtgaacatttcccacttgaatcttgtg
gcttttcaagaggaagtggccaaggaatggacaaatgaggttttcagcttggcaacaaac
ctgctggctcagaacatgtccagagacgcatttctggagaaagcatatactaagctcaag
ctccaggtcaccccagaaggccgcattcctcttaaaaacatctatcgattgttctcagca
gaccggaagcgagttgaaactgcgctagaggcctgtagtcttccatcttcgaggaatgac
tccattccccaagaggacttcactccagatgtatacagagttttcctgaacaatctctgt
ccccgacctgaaattgataacatcttttccgaatttggtgccaaaagcaaaccgtacctg
acggttgatcagatgatggattttatcaaccttaagcagagagatccccggctcaatgaa
atactttacccacctctgaagcaggaacaggtccaagtgttgattgagaaatatgagccc
aacagcagcctcgccaagaaagggcagatgtcagtggatggattcatgcgctacctgagc
ggggaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctgtctcactatttcatcaattcctcgcacaacacctacctcacagctggccagttg
gctgggaactcgtctgtagagatgtatcgccaggtgcttctgtctggatgtcgctgtgtg
gagctggactgctggaagggaaggaccgctgaggaagagcctgtcatcacccatggattc
accatgacaacagaaatatccttcaaggaagtcatagaagccatcgcagagtgtgcgttc
aagacgtctccttttcccatcctcctttcctttgagaaccacgtggattccccgaagcaa
caagccaagatggccgagtattgccgattaatctttggtgatgccctccttatggaacca
ctggaaaaatacccactggaatctggggtacctcttccaagccctatggatttaatgtat
aaaatcttggtgaaaaacaagaagaagtcgcacaagtcgtcagagggaagtggtaaaaag
aagctgtctgagcaggcttccaacacctacagcgactcctccagcgtgttcgagccttca
tctccaggagctggggaagcagatacagagagtgatgacgatgacgacgacgatgactgt
aaaaagtcttccatggatgaggggactgctggcagtgaagccatggccacagaagagatg
tctaacctggtgaactatattcagcctgtcaagtttgagtcctttgaaatttcaaaaaaa
agaaataaaagctttgaaatgtcttccttcgtggaaaccaaaggacttgaacaacttaca
aagtctcctgtggaatttgtagaatacaacaagatgcaacttagcaggatatatcccaag
ggaacacgtgtggattcatccaactacatgcctcaactcttctggaatgctggctgtcag
atggtggcgctcaacttccagacagtggatctagctatgcagataaacatgggcatgtat
gagtacaatgggaagagtggctataggctgaagccagagttcatgaggaggccggacaag
cattttgatccatttactgaaggaatcgtagatgggatagtggccaacactttatctgtt
aagattatttcaggtcagttcctctctgataagaaagttgggacttatgtggaagtggat
atgtttggcttgcctgtggacacaaggaggaaggcatttaaaaccaagacatcccaagga
aatgctgtaaaccctgtctgggaagaagaacctattgtattcaaaaaggtagttctacct
tctctggcctgtttgaggatagcagcatacgaagagggaggcaaatttattggccaccgg
atactgcctgtgcaggctattcggccaggctatcactacatctgcctgcggaatgagagg
aaccagcccctgacgctgccagctgtctttgtctacatagaagtcaaagactatgtgcca
gacacgtatgcagatgtaatcgaagctctatcaaacccaatccgatatgtcaatctgatg
gaacagagagctaagcagctggctgcattgaccctggaggatgaagaggaagtaaagaag
gaggctgaccctggagaaacatcttccgaggctccaagcgaaaccaggacaacgccagca
gagaatggggtgaatcacaccgcatcccttgcacccaagcctccttcccaggctccacac
agccaacctgctccagggtctgtgaaggcacctgccaaaacagaagatctgatccagagc
gtgttaacagaagtagaggcacaaaccatcgaagagctcaagcaacagaagtcgttcgtg
aaacttcaaaagaaacattacaaagaaatgaaagacctggtgaagagacaccacaagaaa
accacggagctcattaaggagcacacgaccaagtacaatgagattcagaatgactacctg
agaaggagggcagccttggaaaaatccgccaaaaaggacagcaagaagaaatctgaaccc
agcagccctgaccacggctcatcagccattgagcaagacctcgctgccctggatgcagaa
atgactcagaagttgatagacttgaaagacaagcaacaacagcagctgcttaatcttcgg
caagagcagtattacagcgagaagtatcagaagcgagaacacattaaactgcttattcag
aagttgacagatgttgcagaagagtgtcagaacaatcagttaaagaagctgaaggaaatc
tgcgagaaagagaagaaggaattaaagaagaaaatggataagaagaggcaagagaagata
acagaagccaagtccaaagacaaaagccagatggaagaggagaagacagagatgatccga
tcatacatccaggaggtggtgcagtacatcaagaggttagaggaagcacaaagtaaaaga
caagaaaaactcgtggagaaacacaatgagatccgccagcagatcctcgatgagaagccc
aagggggaaggctcctcctcagtcttgtcggaaggttgccatgaggacccctctgttccc
cccaactttactccccccaaccctcaagccctcaagtggtga

DBGET integrated database retrieval system