KEGG   Mus caroli (Ryukyu mouse): 110285321
Entry
110285321         CDS       T05910                                 

Gene name
Rasgrp2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04611  Platelet activation
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110285321 (Rasgrp2)
   04014 Ras signaling pathway
    110285321 (Rasgrp2)
   04015 Rap1 signaling pathway
    110285321 (Rasgrp2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110285321 (Rasgrp2)
   04062 Chemokine signaling pathway
    110285321 (Rasgrp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285321 (Rasgrp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110285321 (Rasgrp2)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110285321 (Rasgrp2)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 110285321
NCBI-ProteinID: XP_021007057
Ensembl: MGP_CAROLIEiJ_G0022609
UniProt: A0A6P7QIA4
LinkDB
Position
19
AA seq 608 aa
MASTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLQVY
QQSRKDNSSSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KERLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcgagcactctggacctggacaagggctgcaccgtggaggagctgctccgtggttgc
atcgaagcctttgatgactccggaaaagtgcgagatccacaactagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccaggtctat
cagcaatcccggaaggacaactccagttctctacagatgaaaacgtgtcacttggtcagg
tactggatctcagcctttccagcagagtttgacttgaacccagagctggctgaacaaatc
aaggagctgaaggctctgttagaccaagaagggaaccgcaggcacagcagcctcatcgac
atcgagagtgtccctacctacaaatggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccctgttgtttgatcacttggagcctatggagctggcagaa
catcttacctacctggagtatcgttccttctgcaagatcctgttccaagactaccacagc
tttgtgactcatggctgcaccgtagacaacccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacgcacttcgtgcatgtggcagagaagctactgcagctgcagaacttc
aacacgctgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccacgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctaccggcaactacagcaactacaggcgcaggctggcggcctgcgtgggcttccgc
tttcccatcctgggagtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttctgcatt
ctggaggagttggccatggtgaccagccttcgcccacccgtacaagccaaccccgacttg
ctgagcctgcttacggtgtccctggatcagtatcagacggaggatgagttgtaccagctt
tccctgcagcgagaaccacgctccaagtcgtcgccaaccagccccaccagctgcaccccg
cctccccggccccctgtgttggaagagtggacctcagttgccaagcctaagctggatcaa
gccttggtggtggagcacattgagaagatggtggagtccgtgttccggaactttgacgtg
gatggggacggtcacatctcccaggaggagtttcagatcatccggggcaacttcccttat
ctcagcgcctttggggacctggaccagaaccaggatggctgcatcagcagggaggagatg
atttcctacttcctgcgctccagctcggtgctgggaggccgcatgggcttcgtacacaac
ttccaggagagtaactcgctacgcccggttgcctgtcgccactgcaaagctctgatcctg
ggcatctacaagcagggccttaaatgtagagcttgtggtgtgaactgccacaagcaatgc
aaagagcgcctgtcagtggaatgtcgccgcagggcccagagtgtcagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttttccctgcctcgc
ccaggcaggcgcagctctcggcccccagagatccgcgaggaggaggtgcagacggtggag
gatggagtgtttgacatccacttataa

KEGG   Mus caroli (Ryukyu mouse): 110298815
Entry
110298815         CDS       T05910                                 

Gene name
Rasgrp4
Definition
(RefSeq) RAS guanyl-releasing protein 4 isoform X1
  KO
K12363  RAS guanyl-releasing protein 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110298815 (Rasgrp4)
   04014 Ras signaling pathway
    110298815 (Rasgrp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298815 (Rasgrp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110298815 (Rasgrp4)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110298815 (Rasgrp4)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 EF-hand_1 RasGEF_N EF-hand_9 zf-C2H2_11 SAMP
Other DBs
NCBI-GeneID: 110298815
NCBI-ProteinID: XP_021023953
Ensembl: MGP_CAROLIEiJ_G0029472
UniProt: A0A6P5Q2V0
LinkDB
Position
7
AA seq 683 aa
MNRKDIKRKSHQECSGKAGGRGRPRQARRHKTCPTPREISKVMASMNLGVLSESSCSEDE
LLEECIRCFDSAGSLRRGDHILKMVLTMHSWVLPSSELAARLLTSYPPRTYQKAAKDAQE
LRQLQICYLVRYWLTHHHEAVHQEPQLEAVISRFWTTVAQEGNMAQRSLGDASSLLSPGG
PGPPPPMSSPGLGKKRKVSLLFDHLETEELAQHLTYLEFRSFQAITPQDLRGYVLQGSVR
GCPALEGSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIRVAQRLHQLQNFNTLMAVTG
GLCHSAISRLKDSHVHLSPDSTKALLELTELLSSHNNYAHYRRTWAGCTGFRLPVLGVHL
KDLVSLYEAHPDRLPDGRLHLPKLNSLYLRLQELTALQGQHPPCSANEDLLHLLTLSLDL
FYTEDEIYELSYAREPRCPKSLPPSPFKAPVVVEWAQGVTPKPDSVTLGQHVEQLVESVF
KNYDPEGRGSISLEDFERLSGNFPFACHGLHPPPRHGSGSFSREELTKYLLHASAICSKL
GLAFLHAFQEVTFRKPTFCHSCSSFVSTGPLWGVTKQGYRCRDCGLCCHRHCRDQVRVEC
KKRPETKGDPGPPGAPVPATPLPPANCGSEESLSYTLSPGPESGCHLRHAWTQTESSHSS
WEPEVVPCPAPVLPSKASSKPSV
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgaaccggaaagacatcaaaaggaagtctcatcaggaatgctctgggaaggcaggaggg
cggggtcggccacgtcaggcccgccgccacaagacgtgccccaccccccgggaaatcagc
aaggtcatggcttccatgaatctgggagtgctgagtgagagcagctgcagcgaagatgag
ctactggaggaatgtatccgctgctttgactcggctggcagcctgcgcagaggggaccac
attcttaagatggtgctcacgatgcacagctgggtgctgccatcctcagagcttgctgcc
cgtctgctgacttcatatcctcccagaacctatcagaaggctgccaaagatgcccaagag
ctaagacagctacagatctgttacttggtcaggtactggctgactcatcaccatgaggca
gtgcaccaggaaccccagctggaagcagtcataagccggttttggaccactgtcgctcag
gagggcaacatggcccaaaggagcctgggagatgcctccagcctgctaagtcctggaggg
cccggtcccccacctcccatgagcagcccaggcctgggcaagaagcggaaagtgtcattg
ctgttcgatcacctggagacagaggagctggcacaacaccttacttatctggagttccgg
tccttccaggctatcacaccccaagacctgcggggctatgttttgcagggttcagtgaga
ggttgtccagctctggaaggttctgtgggtctgagcaacagtgtgtcccgctgggtgcag
gtcatggtgctaagtcgtcctgggcctgcacaacgtgcccaggtcctagacaaattcatt
cgtgtggcacagaggcttcaccagctgcagaatttcaacacactgatggcggtcacgggg
ggcctgtgtcatagtgccatctccagactcaaggactcccacgtccatctgagccctgac
agcactaaggccctgctggagctgacagagctcctctcttcccacaacaactatgcccac
taccgccgcacctgggccggctgtactggcttccggctgccagtactgggtgtacacctc
aaggacctggtatctctatatgaggctcatccagacagattgccagatggccgcctgcac
ctacccaagctgaatagcctctatctacggctgcaggagctgacggcgctccagggacag
catcctccctgcagtgccaatgaggacctgctgcacctgctgacgctttccctggatctc
ttctacacagaagatgagatctacgagctttcttatgcccgggaaccccgctgtcccaag
agtctgccaccgtcccccttcaaagcacctgtggtggtagagtgggcccagggtgtgaca
ccaaagccagacagcgtgactctgggtcagcatgtggaacagctggtggagtccgtgttc
aagaactacgacccagaaggccgtggctccatctctctggaggactttgagcggctgtca
ggcaacttcccgtttgcctgccatgggcttcacccacctccccgccacgggagtggctcc
ttcagcagagaggagctgaccaagtacctgctccatgccagtgccatctgctccaagctg
ggcctggccttcctgcacgccttccaggaggtcaccttccgcaagcccaccttctgtcac
agctgcagcagcttcgtgagcactggccctctctggggggtcaccaagcaaggctatcgc
tgtcgggactgtggcctgtgttgtcacagacactgcagggatcaagtgagagtggagtgt
aagaagaggccagagactaagggtgacccggggcccccaggtgcacctgtgccagccaca
ccacttcctcctgccaactgtggctcagaggaaagtctctcctatacactctccccgggt
ccggagtctggttgccaccttcgccacgcttggacccagacggaatcctcacactcttcc
tgggagccagaggtggtgccctgcccagcaccggttttaccgtccaaagcttcctcgaag
cccagcgtctga

KEGG   Mus caroli (Ryukyu mouse): 110311236
Entry
110311236         CDS       T05910                                 

Gene name
Rasgrp1
Definition
(RefSeq) RAS guanyl-releasing protein 1 isoform X1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04611  Platelet activation
mcal04660  T cell receptor signaling pathway
mcal05200  Pathways in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110311236 (Rasgrp1)
   04014 Ras signaling pathway
    110311236 (Rasgrp1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110311236 (Rasgrp1)
   04660 T cell receptor signaling pathway
    110311236 (Rasgrp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311236 (Rasgrp1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110311236 (Rasgrp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110311236 (Rasgrp1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110311236 (Rasgrp1)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 RasGEF_N EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg bZIP_1 DivIC
Other DBs
NCBI-GeneID: 110311236
NCBI-ProteinID: XP_021040144
Ensembl: MGP_CAROLIEiJ_G0024111
UniProt: A0A6P5R5K4
LinkDB
Position
2
AA seq 877 aa
MITSTPVRWLVRESVCTRGSERRERARTNFVPAGAPGSARRAPRVVGSGLRGPAAAEGCA
APGRADPTALGETAPGAQRAAAMGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQ
PSLAQITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIIS
SAELLQKVMNLYKDALEKNSPGVCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVK
ANGEETHCHLIDTTQINSRDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEF
KSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKF
IHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYD
NYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQE
MAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGV
SPKPDPKTISKHVQRMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLIS
RDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMN
CHKQCKDLVVFECKKRIKSPAISTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEV
VDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKSTQTESFPWVGGETPPGHFVLSSPRKS
AQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKA
DNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgataacatcaacgcctgtcaggtggttggtgcgagagagtgtgtgcacgcgcgggagc
gagcgtagggagcgcgctcgcacaaactttgtgcctgcgggtgcgcctgggtcggctcgc
cgggctccaagagtggtcggctccgggctgcgagggccagcggcggccgagggatgcgcg
gcgcccggccgagccgatcccaccgctctaggtgagacggctccaggggcgcagagagcc
gcggccatgggaaccctgggcaaggcaagagaggctccgcggaaaccttgccatggctcc
agagctggccccaaagcaagactagaggccaaatcaaccaacagccctctccctgcccag
cccagcttggcccagatcacccagttccgaatgatggtgtccctgggacatttggccaaa
ggagccagcctggatgatcttattgacagctgcattcaatcttttgatgcggatggaaac
ctgtgtcggaataaccaactgctacaagtcatgctaaccatgcaccggatcatcatctcc
tcagccgagctgctacaaaaagtcatgaatctatataaggatgccctggaaaagaattct
ccaggagtttgcctgaagatctgctattttgtcaggtattggataacagaattctggatc
atgttcaaaatggatgccagcttgaccagcaccatggaagagttccaagacctggtgaaa
gccaatggtgaagagacccactgccacctcatcgacacgacgcaaattaattctcgagac
tggtccaggaaactgactcagaggataaaatcgaatactagcaagaagcgcaaagtgtcc
ctgctttttgaccatctggaacctgaagaactgtctgaacacctcacctaccttgagttc
aagtccttccgacggatatctttctctgattaccaaaattaccttgtaaatagctgcgta
aaagagaaccccaccatggagaggtccattgccctgtgcaatggcatctcccagtgggta
caactgatggttctcagccgtcccactccgcagctccgggcagaggtcttcatcaagttc
atccatgtggctcagaaactccaccagctacagaacttcaacacgctgatggctgtgatt
gggggactgtgtcacagctccatctccaggcttaaggagacaagttcacatgtcccacat
gagatcaataaggttctgggtgagatgactgaactgctgtcctcctgcagaaactatgac
aactacaggagagcctatggggagtgcacccacttcaaaatccccatactgggtgtgcac
ctcaaggacctcatatccctgtatgaagccatgcccgactatctggaagatgggaaggtg
aacgtccaaaagctcctggccctttacaatcatatcaatgaattggtccagctgcaggag
atggccccaccattggatgccaacaaggacttggtgcatctgctgacgttatccctggat
ctatactacacagaagatgaaatttatgagctttcctacgcccgggagccgaggaaccac
agagctccgccactgacaccttcgaagccaccagttgtagtagactgggcctctggagtg
tctcccaaacctgacccgaagaccatcagcaaacacgtccaaaggatggtggattctgtc
tttaagaactatgatctcgaccaggatggatatatctctcaggaggaatttgagaagatc
gctgcaagctttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagc
agagacgagatcacggcctacttcatgagggccagctccatctattccaagctgggcctg
ggctttccacacaactttcaagagaccacttacctgaagcccaccttctgtgacaactgt
gctggctttctctggggcgtgatcaagcaaggctatcgctgtaaagactgcgggatgaac
tgccacaaacagtgcaaagacctggtggtgttcgagtgcaagaaacggatcaagagccca
gcaatatccacagagaacatcagctctgtggtaccaatgtccaccctttgtccactggga
accaaagatctgctccatgcacctgaagaaggatctttcattttccaaaacggagaggtc
gtggaccacagtgaggagagcaaggataggaccatcatgctcctgggagtgtcctcccag
aaaatttcagttcggctgaagaggactgttgcccacaagagcacccaaacagaatcgttc
ccgtgggttggtggcgagacaccccctggtcactttgtgctgtcttctccaaggaagtca
gcgcagggtgctctttatgtgcacagtccagcatctccatgccccagcccagcactggtc
cgaaagcgggcattcgtcaagtgggagaacaaagagtcccttataaaaccaaaaccagaa
cttcacctccggctccggacctaccaagaactggaacaggaaataaataccctgaaagca
gataacgatgctctgaagatccaactgaagtacgcacagaaaaaaatagaatccctgcag
cttgggaaaagcaatcatgtcttagcccagatggaccacggtgatagtgcttaa

KEGG   Mus caroli (Ryukyu mouse): 110312642
Entry
110312642         CDS       T05910                                 

Gene name
Rasgrp3
Definition
(RefSeq) ras guanyl-releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04662  B cell receptor signaling pathway
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110312642 (Rasgrp3)
   04014 Ras signaling pathway
    110312642 (Rasgrp3)
   04015 Rap1 signaling pathway
    110312642 (Rasgrp3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    110312642 (Rasgrp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312642 (Rasgrp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110312642 (Rasgrp3)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110312642 (Rasgrp3)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 RasGEF_N
Other DBs
NCBI-GeneID: 110312642
NCBI-ProteinID: XP_021042072
Ensembl: MGP_CAROLIEiJ_G0021882
UniProt: A0A6P7QKY0
LinkDB
Position
17
AA seq 691 aa
MGSNGLGKSATLDELLSTCIEMFDDNGELNDSYLPRIVLLMHRWYLSSTELAGKLLCMYR
NASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDI
SSIPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNT
LMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKSDPTIINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTV
QAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggggtccaacgggctcgggaaatcggcaacactagatgaacttctcagcacatgcatt
gagatgtttgatgacaatggagaactgaacgacagttacttgcccagaattgtgttactg
atgcaccgatggtatttatcctccactgaactggcaggaaaactcctctgcatgtatcgg
aatgccagtggagaaagctgtgatgagttccgactgaagatctgctatttcatgaggtac
tggattctgaaatttcctgcagagtttaatttggatcttggtttgattcgcatgactgag
gagttccgggaagtagctagtcaactaggacatgaaaaacacatcagcctcatggacata
tctagcattccttcctatgactggatgaggagagtcacacagaggaaaaaagtatcgaaa
aggggaaaggcctgtctcttatttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcacagattatcagagctatgtc
atccatggctgtctggagaataacccaacattggagagatctattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaagtgctcagcaaagggcagaa
gtcatcacaaagttcatcaatgtagcccagaaactccttcaactaaaaaattttaacacc
ttgatggcagtggttggtggccttagtcacagctccatttcccgactcaaagacacccat
tctcacctctcttccgaagttacaaagaactggaacgaaatgacagagttggtctcctcc
aatggcaattattgcaattaccgcaaggcctttgctgactgtgatggcttcaaaatcccc
atccttggcgtgcacttgaaagacttgatagcagtccatgtcattttcccagactggatg
gaggagaacaaagtgaacgttgtgaaaatgcaccagctttctgttaccctgagtgaactg
gtctccctgcagaatgcctctcaccacttggaacctaacatggatttgatcaacctactc
accctctctctggacctctaccacacagaggatgatatttacaaactgtcactggtgttg
gaacctagaaattccaaatcgcagccaacctccccaacgacacctaataagcctgtggta
cctctggagtgggcttcagaagtggtaccaaagtcagaccccacaatcatcaacaaacac
ataaggaagttggttgagtctgtgtttcgaaactacgatcatgaccacgatggttacatc
tcccaagaggactttgagagcatagctgccaatttccccttcctggattccttctgcgtg
ctagacaaagatcaggacggcctaattagcaaagacgaaatgatggcttatttcctgaga
gctaaatctcagctacactgcaaaatgggaccaggcttcatccataattttcaggagatg
aactatctcaagccgaccttctgtgaacactgtgcgggatttctctggggcataatcaaa
caaggctacaagtgcaaagactgtggagccaactgtcacaagcagtgcaaagacctcttg
gttctggcctgcaggagacttgccagggcaccctccttgagcagcaaccccgggtcactg
cctggaagcccagccttacctccagtgcaggatgaggtatttgagtttcctggggtcaca
gctggacaccgagacctggacagcagagccattaccctggtaacaggatcttcccggaag
atctccgtgaggctgcagagagccaccactagtcaagccacccagacagaacctgtgtgg
tcagaggctgtctggggagactcagggtctcataccttccccaaaatgaaatccaagttc
catgacaaagcagcaaaggacaagggctttgccaagtgggaaaacgagaagcccaccgta
caagctggtgtggatgttgtagatcgaggcactgcatttgaacctgaccaggatgatggg
caagatgaagccaaacagggtggtgaggatggctga

DBGET integrated database retrieval system