KEGG   Mus caroli (Ryukyu mouse): 110285417
Entry
110285417         CDS       T05910                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal04931  Insulin resistance
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110285417 (Rps6kb2)
   04350 TGF-beta signaling pathway
    110285417 (Rps6kb2)
   04371 Apelin signaling pathway
    110285417 (Rps6kb2)
   04066 HIF-1 signaling pathway
    110285417 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    110285417 (Rps6kb2)
   04152 AMPK signaling pathway
    110285417 (Rps6kb2)
   04150 mTOR signaling pathway
    110285417 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110285417 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110285417 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110285417 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    110285417 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    110285417 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110285417 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285417 (Rps6kb2)
   05205 Proteoglycans in cancer
    110285417 (Rps6kb2)
   05231 Choline metabolism in cancer
    110285417 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110285417 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110285417 (Rps6kb2)
   05212 Pancreatic cancer
    110285417 (Rps6kb2)
   05225 Hepatocellular carcinoma
    110285417 (Rps6kb2)
   05226 Gastric cancer
    110285417 (Rps6kb2)
   05221 Acute myeloid leukemia
    110285417 (Rps6kb2)
   05224 Breast cancer
    110285417 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110285417 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110285417 (Rps6kb2)
   05163 Human cytomegalovirus infection
    110285417 (Rps6kb2)
   05165 Human papillomavirus infection
    110285417 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110285417 (Rps6kb2)
   01522 Endocrine resistance
    110285417 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110285417 (Rps6kb2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110285417 (Rps6kb2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110285417 (Rps6kb2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 110285417
NCBI-ProteinID: XP_021007220
Ensembl: MGP_CAROLIEiJ_G0022495
UniProt: A0A6P5P0K8
LinkDB
Position
19
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPE
RIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLA
KKFLKRNPIQRIGGGPGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDA
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPPPSSPPPTSTAPLPIRPPSGTKKSKKGR
GRSGH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatttagacttggagaccgaggaagggagcgaaggcgagggcgaa
cctgagttcagcccggcggacgtgtgtccccttggcgagttaagggctgctggcctggag
acagtgggacactatgaagaagtagagctgacagagagcagcgtgaacctgggtcctgag
cgcatcgggccccactgctttgagctactgagtgtactgggcaaggggggctatggcaag
gtgttccaggtgagaaaagtgcaaggcaccaacttgggaaaaatatatgccatgaaggtc
ttgaggaaggccaagattgtatgcagtgccaaggacacagcccatacccgggctgagagg
aacattctagaatctgtgaagcatcccttcattgtagaactggcctatgctttccagaca
ggtggcaaactctacctcatcctggagtgcctcagtggtggtgagctcttcacacatctt
gagcgagaaggcatcttcctggaagacacagcctgcttctacctggcagagatcacacta
gccctgggccatctccattcccatggcatcatctaccgagatctcaagcctgagaacatc
atgctcagcagccagggccacatcaaactgacagactttggactctgcaaggagtccatt
catgagggtgctgtcactcacaccttctgcggcaccattgagtacatggccccagagatt
ctagtgcgcactggtcacaaccgggcagtggattggtggagcctgggagccctgatgtac
gacatgctcactggatcgccgcccttcactgcagagaaccggaagaaaactatggataaa
atcattaaagggaagctggtgctgcccccctacctcaccccggatgcccgggaccttgcc
aaaaagtttctgaagcggaatcccattcagcgaattgggggtggcccgggagatgctgct
gatgtgcagaggcacccctttttccgccatatcaattgggatgacctcttggcccgccgc
gtggaccctcccttcaggccgagtctgcaatcagaagaggatgtgagccagtttgatgca
cgattcacacggcagacgcctgtagatagtccagatgacacagccctcagtgagagtgcc
aaccaagccttcctgggcttcacatatgtggcaccttctgtcctggacagcatcaaagag
ggcttctccttccagcccaagctgcgttcccccagacgccttaacagcagtccccgcacc
cccatcagccccctcaagttctctccctttgaggggttccggcccagtcctggcccacca
gagcccatggagccatctctacctccactcctaccaccaccatcatcaccaccacccaca
agcactgcccctcttcccatccgtcctccctcaggaaccaagaagtccaagaagggacgg
ggccgctcagggcattag

KEGG   Mus caroli (Ryukyu mouse): 110304919
Entry
110304919         CDS       T05910                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal04931  Insulin resistance
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110304919 (Rps6kb1)
   04350 TGF-beta signaling pathway
    110304919 (Rps6kb1)
   04371 Apelin signaling pathway
    110304919 (Rps6kb1)
   04066 HIF-1 signaling pathway
    110304919 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    110304919 (Rps6kb1)
   04152 AMPK signaling pathway
    110304919 (Rps6kb1)
   04150 mTOR signaling pathway
    110304919 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110304919 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110304919 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110304919 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    110304919 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    110304919 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110304919 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304919 (Rps6kb1)
   05205 Proteoglycans in cancer
    110304919 (Rps6kb1)
   05231 Choline metabolism in cancer
    110304919 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110304919 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304919 (Rps6kb1)
   05212 Pancreatic cancer
    110304919 (Rps6kb1)
   05225 Hepatocellular carcinoma
    110304919 (Rps6kb1)
   05226 Gastric cancer
    110304919 (Rps6kb1)
   05221 Acute myeloid leukemia
    110304919 (Rps6kb1)
   05224 Breast cancer
    110304919 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110304919 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110304919 (Rps6kb1)
   05163 Human cytomegalovirus infection
    110304919 (Rps6kb1)
   05165 Human papillomavirus infection
    110304919 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304919 (Rps6kb1)
   01522 Endocrine resistance
    110304919 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304919 (Rps6kb1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110304919 (Rps6kb1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110304919 (Rps6kb1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110304919
NCBI-ProteinID: XP_021032269
Ensembl: MGP_CAROLIEiJ_G0016915
UniProt: A0A6P5QMP2
LinkDB
Position
11
AA seq 525 aa
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacctagcgcctgacttccgacacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaagatgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaggacacagcccacaca
aaagcagagcggaacattctggaggaagtcaagcaccctttcattgtggacctgatttat
gcctttcagaccggtgggaagctctacctcatcctcgagtatctcagtggaggagaactg
tttatgcagttagaaagagagggaatattcatggaagacacagcatgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttaatgagaagcggccacaaccgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagtccaagctcatccatttttcagacacattaactgggaagaactt
ctggcgcggaaggtggaacctccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagccctgatgactccactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcatttgaaccaaaaatccgatctcctagaagatttattggt
agcccacgaacgcctgtcagcccagtcaaattctctcctggggatttctggggacgaggt
gcttcagccagcacggcaaatcctcagacccccgtggaatacccaatggaaacaagtggg
atagagcagatggatgtgacagtgagcggggaagcatcagcgccacttccaatccgacaa
cccaactccgggccgtacaaaaaacaagcttttcctatgatctccaagcggccagagcac
ctgcggatgaatctatga

DBGET integrated database retrieval system