KEGG   Mus caroli (Ryukyu mouse): 110285509
Entry
110285509         CDS       T05910                                 

Gene name
Itga6
Definition
(RefSeq) integrin alpha-6
  KO
K06485  integrin alpha 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04514  Cell adhesion molecules
mcal04640  Hematopoietic cell lineage
mcal04810  Regulation of actin cytoskeleton
mcal05145  Toxoplasmosis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110285509 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110285509 (Itga6)
   04514 Cell adhesion molecules
    110285509 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110285509 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110285509 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110285509 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285509 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110285509 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110285509 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110285509 (Itga6)
   05414 Dilated cardiomyopathy
    110285509 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110285509 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110285509 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110285509 (Itga6)
   04515 Cell adhesion molecules [BR:mcal04515]
    110285509 (Itga6)
   04090 CD molecules [BR:mcal04090]
    110285509 (Itga6)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110285509 (Itga6)
  Exosomal proteins of breast milk
   110285509 (Itga6)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110285509 (Itga6)
CD molecules [BR:mcal04090]
 Proteins
  110285509 (Itga6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF4381 LRR19-TM
Other DBs
NCBI-GeneID: 110285509
NCBI-ProteinID: XP_021007401
Ensembl: MGP_CAROLIEiJ_G0023648
UniProt: A0A6P5P4M9
LinkDB
Position
2
AA seq 986 aa
MSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIED
DMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNT
FFDMNIFEDGPYEVGGETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANH
SGAVVLLKRDMKSAHLLPEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDG
EVGGAVYVYINQQGKWSNVKPIRLNGTKDSMFGISVKNIGDINQDGYPDIAVGAPYDDLG
KVFIYHGSPAGIITKPTQVLEGTSPYFGYSIAGNMDLDRNSYPDLAVGSLSDSVTIFRSR
PVINILKTITVTPNRIDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAE
KERRKSGLSSRVQFRNQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITAS
VEIQEPSSRRRVNSLPEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTR
EGNQDKFSYLPIQKGIPELVLKDQKDIALEITVTNGPSDPRNPRKDGDDAHEAKLIATFP
DTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTT
DLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDE
VGSLIEYEFRVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHN
EINYLKLKESHNSRKKRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVTIRCPLRGLD
SKASLVLRSRLWNSTFLEEYSKLNYLDILVRASIDVTAAAQNIKLPHAGTQVRVTVFPSK
TVAQYSGVAWWIILLAVLAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEERE
IKDEKHMDSLEKKQWITKWNENESYS
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgtcagaaagcaaggaagaccagtggatgggagtcactgtccagagccaaggtcccggg
ggaaaagtggtgacatgtgcgcatcgatacgagaaacggcagcacgtcaacacgaagcag
gagtcacgggatatcttcggaagatgttatgtcctgagtcagaatctcagaattgaagat
gatatggacggaggagactggagtttctgcgatggccggttgagaggccatgaaaagttt
ggttcctgtcagcaaggagtagcggctactttcactaaggactttcattacattgttttt
ggagccccagggacttacaactggaaagggatcgtccgtgtagaacagaagaataacact
ttttttgacatgaacatctttgaggacggcccctatgaagttggcggagagactgaccat
gacgaaagtctcgtgcccgtccctgctaacagttatctaggcttttcactggactcaggg
aagggtattgtttctaaagatgacatcacttttgtgtctggtgctccaagagccaatcac
agtggggctgtagttttgctaaaaagagacatgaagtccgcacatctgctccctgagtat
atatttgatggagaaggcctggcttcctcgtttggctatgatgtggcagtggtggacctc
aatgcagatgggtggcaagacatcgttattggagctccacagtattttgatagggatggt
gaagtcgggggtgcagtttacgtctacattaaccagcaaggcaaatggagtaatgtgaag
ccgattcgtctaaacgggaccaaagactcgatgtttggaatctctgtgaaaaatataggt
gatattaaccaagatggctatccagatattgctgttggagctccttatgatgatctgggg
aaggtttttatctatcatggatccccggctggcataattaccaagccaacacaggttctc
gaggggacatcgccttacttcggctattcaatcgctgggaatatggacctggatcggaat
tcctaccctgaccttgctgtgggctccctctcagactcagtcactattttcagatcccgg
ccagtgattaacattctaaaaaccatcacagtgactcctaacagaattgacctccgccag
aaatccatgtgtggctcacctagcgggatatgcctcaaggttaaagcctgttttgaatat
acggcgaaaccttccggttataaccctccaatatcaattttgggtattcttgaagctgaa
aaagaaagaagaaagtcagggttgtcatcgagagttcagtttcgaaaccaaggttctgag
ccaaagtatactcaggagctgaccctgaatcggcagaagcagcgggcgtgcatggaggag
accctctggctgcaggagaacatcagagacaagctgcgtcctatccccatcacggcttct
gtggagatccaggagcccagctctcgccggcgggtgaactcacttcctgaagttcttccc
atcctgaattcgaatgaagccaaaacggtccagacagatgtccacttcttaaaggaagga
tgtggagacgacaatgtctgtaacagcaaccttaagctagagtataaatttggtacccga
gaaggaaatcaagacaaattctcttaccttccaattcaaaagggcatcccagaattagtc
ctaaaagatcagaaagatatagctctggaaataacggtgaccaacggcccttcggatcca
aggaatccccggaaagatggcgacgatgcccatgaagccaaactcatcgccacgtttcca
gacactctgacttattccgcttacagagaactgagggctttccctgagaagcagctaagc
tgtgtggccaaccagaatggctcccaagcggactgtgagctcggaaatcctttcaagaga
aattccagtgttactttttatctgattttaagtacaactgaggtcacctttgacaccaca
gatctggatattaatctgaagttggaaacaacaagcaatcaggataatttggctccaatt
acagcgaaggcaaaagtggttattgaattgcttttatcggtctccggagtcgctaagcct
tcgcaggtgtattttggaggtacagttgttggtgagcaagctatgaaatctgaagatgaa
gtgggaagtttaatagaatatgaattcagggtgattaacttaggcaaacctcttaaaaac
ctcggcacagcaacgttgaatatacagtggcccaaggagattagcaatggcaaatggttg
ctttatttgatgaaagttgaatccaaaggtttggagcagattgtttgtgagccacacaat
gaaataaactacctgaagctgaaggagtctcacaactcaagaaagaaacgggaacttcct
gaaaaacagatagatgacagcaggaaattttctttatttcctgaaagaaaataccagacc
ctcaactgcagcgtcaacgtgaggtgtgtgaccatcaggtgcccactccgagggctggac
agcaaggcctctctcgttctgcgctccagattgtggaacagtacatttctagaggaatat
tccaaactgaactacttggacattctcgtgagggcttcaatagatgtgactgctgctgct
cagaacatcaagctccctcacgcgggcactcaggttcgagtgacggtgtttccctcaaag
actgtagctcagtattcaggggtagcttggtggatcatcctcctggctgttcttgctggg
attctgatgctggctctattagtgtttttactgtggaagtgtggattctttaagcgctct
aggtacgatgacagcgttccccgataccatgcggtgcggatccggaaagaagagcgagag
atcaaagatgagaaacacatggatagcctcgaaaaaaaacagtggatcaccaagtggaat
gaaaatgaaagttactcatag

KEGG   Mus caroli (Ryukyu mouse): 110304308
Entry
110304308         CDS       T05910                                 

Gene name
Itga3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04640  Hematopoietic cell lineage
mcal04810  Regulation of actin cytoskeleton
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110304308 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110304308 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304308 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110304308 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110304308 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304308 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110304308 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110304308 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110304308 (Itga3)
   05414 Dilated cardiomyopathy
    110304308 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304308 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304308 (Itga3)
   04515 Cell adhesion molecules [BR:mcal04515]
    110304308 (Itga3)
   04090 CD molecules [BR:mcal04090]
    110304308 (Itga3)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110304308 (Itga3)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110304308 (Itga3)
CD molecules [BR:mcal04090]
 Proteins
  110304308 (Itga3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N
Other DBs
NCBI-GeneID: 110304308
NCBI-ProteinID: XP_021031244
Ensembl: MGP_CAROLIEiJ_G0017000
UniProt: A0A6P5QDT3
LinkDB
Position
11
AA seq 1053 aa
MGPGPCRVPRAPGWLLRALALMVAACGRVAFAFNLDTRFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEEQGNLYIGYTVQVGSAILHPSDIITVVTGAPRHQHMGAVFLLKQESGGDLQRKQVLK
GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGASFPDQPSL
LLHGPSRSAFGISIASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLRQPQQIIDG
EKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAV
LDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVF
HGFFSMPETRCQTLELLLMDNVRDKLRPIIIAMNYSLPLRMPDRLKLGLRSLDAYPVLNQ
AQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLHPLSRLQYSRDTKKLFLSINVTN
SPSSQRAGEDAHEALLTLEVPSALLLSSVRPSGTCQADNQTILCELGNPFKRNQRMELLI
AFEVIRVTLHTRALPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLMNHRLQSFFGGT
VMGEAAMKTVEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITI
HSNGSWPCQPSGNLVNPLNLTLSDPGVTPLSPQRRRRQLDPGGDQSSPPVTLAAAKKAKS
ETVLTCSNGRARCVWLECPLPDASNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFL
RTSISTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIIILLWKCGF
FKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgggccccggcccctgccgcgtgccccgcgcccctggctggctgctccgcgctctggcc
ttgatggtggcggcttgcggccgggtcgccttcgccttcaacctggacacccgattcctg
gtggtgaaggaggcggtgaaccccggtagcctcttcggctactcggtcgccctccatcgg
cagactgagcgacagcagcgctacctccttctggccggggctccccgagacctcgctgtg
ggtgatgactataccaaccggactggtgctgtgtacctgtgtcccctcacggcccacaag
gacgactgtgaacggatggacatttcagagaaaagtgaccctgaccatcacattattgag
gatatgtggcttggagtgactgtggccagccagggccctgcaggtcgagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctagaagaccagcggcgcatggtgggc
aagtgctatgtgcgtggcaacgacctacagcttgaccccggcgatgactggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagaccggcatgtgccagctgggc
accagcggcggcttcacccagaacactgtatacttcggtgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatctgaatatagctacagg
ggctcggaggagcaaggaaacctttatattgggtacacggtgcaggtaggcagcgccatc
ctacatccctcggacatcatcactgttgtgacgggtgccccacggcaccaacatatgggc
gctgtcttcttgctgaagcaagagtcaggtggagacctgcagaggaagcaggtgctgaag
ggcacgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgat
gggtggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtaggg
ggtgccgtctatgtcttcatgaaccaggcgggcgcatccttccctgatcaaccttccctc
ctgcttcacggccccagccgctctgcctttggcatctctatagccagcatcggtgacatc
aaccaggatggattccaggacatcgccgtgggagccccatttgagggcttgggcaaagtc
tacatctaccacagcagctccggggggctcctcaggcagccccagcagataatcgatgga
gagaaactcggactgccaggcttggccacctttggctactccctgagcgggaagatggac
gtagatgaaaacctttacccagacctgctagtagggagcctgtcggaccacatcgtgctg
ctgcgggcccggcctgtcatcaatatcctccataggaccttggtggccaggccagctgtg
ttggaccctgcgctttgtacagctacctcctgtgttcaggtggagctgtgctttgcctac
aaccagagcgctgggaaccccaactacaggcggaacatcaccctggcttacacactggag
gctgacagggaccgacgcccacccaggctccgatttgcccgcagccagtcgtctgtcttc
cacggcttcttctccatgccagagacacgttgccagacactggagttactgctgatggac
aatgttcgcgataaactccgtccgatcatcattgccatgaactactccttacctctgcgc
atgcctgatcgcctcaagctgggcttgcggtctctggatgcctacccagtcctcaaccag
gcacaggctatggagaatcacactgaggtccacttccagaaagagtgcgggccagacaac
aagtgtgacagcaacctgcagatgcgagcagccttcctgtctgagcagctgcatcctttg
agcaggctccagtacagcagagacactaagaaactgtttttgagcatcaatgtgaccaat
tcaccgagcagccaacgggctggggaagatgcgcatgaggcattgctcaccctagaggtg
ccatccgccctgctactgtcctcagtgcgcccgtctgggacctgccaagctgataatcag
accatcctgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatt
gcctttgaggtcatcagggtaacgttgcacacgagggccctcccagtacttcttcagctg
tccacgtcgagtcaccaggacaacttgcagcccgtactcctgactttgcaggtggactac
accctccaggcctcgctcagcttaatgaatcatcggctgcagagcttctttggtggcaca
gtgatgggtgaggctgccatgaaaactgtggaggatgtgggaagtcccctgaaatatgaa
ttccaggtgagcccagtgggagatgggctggcagccttgggcacactggttctaggtctg
gagtggccctatgaagttaccaatggcaagtggctgctgtaccccacggagatcaccatc
catagcaatgggtcctggccctgccagccgtctggaaaccttgtcaaccctctcaacctt
actctctctgaccctggagtcacaccactgtcgccacagcgccggcggcggcaactggat
ccagggggagaccagagttccccgcctgtcacgctagctgctgccaaaaaagccaagtct
gagactgtgttgacctgctccaatggccgcgcccgctgcgtgtggctggagtgccccctt
ccagacgcctccaacattaccaatgtgaccgtgaaggcacgggtgtggaacagcaccttc
attgaggactacaaagactttgacagagtcagggtagatggctgggctaccctgttcctg
agaaccagcatctctaccatcaacatggagaacaagaccacatggttctctgtggacatt
gactcagagctggtggaggagctgccggctgagatcgagctgtggttggtgctggtggcc
gtgggtgctgggttgctgctgctggggctcatcattatcctcttgtggaagtgcggcttc
ttcaagcgagcccgcactcgtgccctgtatgaagctaagaggcagaaggctgagatgaag
agccagccgtcagagacagaaaggctgaccgacgactactga

KEGG   Mus caroli (Ryukyu mouse): 110304761
Entry
110304761         CDS       T05910                                 

Gene name
Itga2b
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04640  Hematopoietic cell lineage
mcal04810  Regulation of actin cytoskeleton
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110304761 (Itga2b)
   04151 PI3K-Akt signaling pathway
    110304761 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110304761 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304761 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110304761 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110304761 (Itga2b)
   04611 Platelet activation
    110304761 (Itga2b)
   04613 Neutrophil extracellular trap formation
    110304761 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304761 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110304761 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110304761 (Itga2b)
   05410 Hypertrophic cardiomyopathy
    110304761 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110304761 (Itga2b)
   05414 Dilated cardiomyopathy
    110304761 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304761 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110304761 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304761 (Itga2b)
   04515 Cell adhesion molecules [BR:mcal04515]
    110304761 (Itga2b)
   04090 CD molecules [BR:mcal04090]
    110304761 (Itga2b)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110304761 (Itga2b)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110304761 (Itga2b)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110304761 (Itga2b)
CD molecules [BR:mcal04090]
 Proteins
  110304761 (Itga2b)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 110304761
NCBI-ProteinID: XP_021032000
Ensembl: MGP_CAROLIEiJ_G0017254
UniProt: A0A6P5QTB6
LinkDB
Position
11
AA seq 1033 aa
MAGASCAWHSLWLLQWTPLFLGPSAVPPAWALNLDSVKFSVYAGPNGSHFGFSVDFHKDK
HGSVSIVVGAPRALNASQEETGAVFLCPWKVNGGKCNPLLFDLRDETRNLGFQIFQTFKT
GQGLGASVASWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFLAQLQSGGRAEYSPCRAN
TMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLARVPIENIISSYRPG
TLLWHVSNQRFTYDNSNPVFFDGYQGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEIL
NSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMERRADRKLAEVGRVYL
FLQPKGSQALSAPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQL
DLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICHTTGAFLRDEADFRDKLSPIVLSLN
VSLPPEETGGAPAVVLHGETHVQEQTRIILDCGEDDLCVPQLRLTATAGDSPLLIGADNV
LELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELG
NPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVMLPVAVQAEATVEL
RGNSFPASLVVAAEEGDREQDDLDSWISRVEHTYELHNIGPGTVNGLRLLIHIPGQSQPS
DLLYILDVQPQGGLLCSTQPSPKVDWKLPTPSPSSIRPVYHQRERRQAFLQGPKPGQQDP
VLVSCDGSASCTVVECELQEMVRGQRAMVTVQAMLGLSSLRQRPQEQFVLQSHAWFNVSS
LPYSVPVVSLPSGQARVQTQLLRALEERAIPVWWVLVGVLGGLLMLTLLVLAMWKAGFFK
RNRPPLEEDEEEE
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggccggagcctcctgcgcatggcattccctgtggcttctgcagtggacaccactgttc
ttgggtcctagtgctgttcctccagcctgggccttgaacctggactctgtgaagttctcc
gtctatgcaggccccaatggcagccactttggcttctcagtggactttcataaggacaaa
catggaagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaagtcaagaggag
actggagccgtgtttctgtgcccctggaaggtcaatggtggcaagtgcaacccgttgctc
ttcgacctcagggatgaaacacgaaacctaggcttccaaattttccaaaccttcaagacc
gggcaaggacttggggcgtcggtcgccagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctggaaaagcgcgatgaggcagagaagactccggtaggaggc
tgcttcttggctcagctccaaagcgggggccgcgcagagtactcgccctgtcgcgccaac
accatgagttccgtttacgccgagagttttcgcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggagcccctggaggctacttt
tttttaggtctcctggctcgcgttccaattgagaacatcatctcgagctaccgcccgggt
acccttttgtggcatgtttccaaccagcgcttcacctacgacaacagcaacccagtgttt
ttcgacggttaccagggatattcggtagccgtgggcgagttcgatggggatccgagcact
acagagtacgtatcgggtgcccccacttggagctggaccttgggagcggtggaaattttg
aactcctactaccagcccctgcaccggcttcatggagaacagatggcttcatatttcggg
cactcggtggcagtcactgacgtcaacggggacgggaggcatgacctactggtgggggct
ccattgtatatggagagaagggcagaccgcaagctggccgaggtgggccgcgtgtatttg
tttctgcagcctaagggctcccaagctctgagcgcacccactctcctgctgactggcacc
cagctctatgggagatttggatctgccattgcacccctgggtgacctcaaccgagatggc
tataatgatgttgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattcctgggtcagagtgaagggctgagtccacgcccctcccaggttctggacagcccc
ttccccacaggctctggctttggcttctcccttcgtggtgctgtagacatcgatgacaat
ggatacccagacctgattgtgggagcatatggggctagcaaggtggctgtgtacagagct
cagcctgtggtgatggccactgtccagctgatggttcaagactccctgaatccgacactg
aagaactgtgtcctggatcagaccaagacaccagtcagctgcttcaacatccagatgtgt
gtgggagccacaggacacaacattcctcagaagctgcatctaaaggcagagctgcagctg
gacttacagaagccccgtcagggccgccgggtgctcctgttggcttcccaacaggcgagc
ctcaccctgagcctggacctgggtggaagagacaaacctatctgccacaccacgggggcc
ttccttcgggatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaac
gtgtcgctgcccccagaggagactggaggagcccctgccgtggtattgcatggagaaact
catgtccaggagcagacacggatcatcctggattgtggggaagacgacctgtgcgtgcca
cagctccgactcacagctactgcgggggactccccactcctaattggtgctgacaatgtg
ttggagctgaagattgaagcagccaatgatggtgagggagcctatgaggcggagctggcc
gtgcacctgcctccaggtgcccactacatgcgggctctcagcaacattgagggctttgag
aggctcgtctgcactcagaagaaagagaatgagtccagggtggccctctgtgagctgggc
aaccccatgaaaaaggacacccggataggaatcacaatgctggtgagcgtggagaacctg
gaagaagctggcgagtccgtgtccttccagctgcaggtcaggagcaagaacagccagaat
ccaaacagtaaggtcgtgatgttgcctgtggcagtccaagctgaagccacagtggagctt
cgagggaattccttccctgcctccctggtggtggcagcagaagaaggtgacagggaacag
gacgacttggacagctggatctccagggtggagcacacctatgagctccacaacattggc
cctggcactgtgaacggcctcagactcctcatccacattcctggccagtcccagccctcg
gacctactctacatcctggatgtgcagccgcagggaggtctcctttgctccacacagcca
tctcccaaggtggactggaaactacccacgcccagcccttcttccattcgtcctgtctat
caccagcgtgagcgcagacaggcattcctgcaggggcccaagccagggcagcaggaccca
gtactggtgagctgcgacggctcagcgtcctgtacggtggtggaatgtgagctgcaggag
atggtgcgcgggcagcgggccatggtcaccgtgcaggccatgctggggctgtccagcctc
cgccagaggccgcaggagcagtttgtgctacagtcgcacgcctggttcaacgtctcctcc
ctaccttactcggtgccggtggtcagcttgcccagtgggcaagctcgggtgcagacacag
ctgcttcgggccttggaggagagggccattcctgtctggtgggtgctggtgggcgtgctg
ggcggtctgctgatgttgaccctgctagttttggccatgtggaaggctggcttcttcaag
cggaatcgaccgcctctggaggaagatgaagaggaagagtga

KEGG   Mus caroli (Ryukyu mouse): 110308074
Entry
110308074         CDS       T05910                                 

Gene name
Itga2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04611  Platelet activation
mcal04640  Hematopoietic cell lineage
mcal04810  Regulation of actin cytoskeleton
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110308074 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110308074 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110308074 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110308074 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110308074 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110308074 (Itga2)
   04611 Platelet activation
    110308074 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308074 (Itga2)
   05205 Proteoglycans in cancer
    110308074 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110308074 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110308074 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110308074 (Itga2)
   05414 Dilated cardiomyopathy
    110308074 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110308074 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110308074 (Itga2)
   04515 Cell adhesion molecules [BR:mcal04515]
    110308074 (Itga2)
   04090 CD molecules [BR:mcal04090]
    110308074 (Itga2)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110308074 (Itga2)
  Exosomal proteins of bladder cancer cells
   110308074 (Itga2)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110308074 (Itga2)
CD molecules [BR:mcal04090]
 Proteins
  110308074 (Itga2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha DUF11 HisK_sensor
Other DBs
NCBI-GeneID: 110308074
NCBI-ProteinID: XP_021036074
Ensembl: MGP_CAROLIEiJ_G0018913
UniProt: A0A6P5QZ90
LinkDB
Position
13
AA seq 1178 aa
MGPGQAGGALLLRLLVLVQGILSCLAYNVGLPGAKIFSGPSSEQFGYSVQQLTNPQGNWL
LVGSPWSGFPENRMGDVYKCPVDLPTATCEKLNLQNSSSISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDLQFLASFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLVKFVKGLHIGPKKTQVALIQYANDPRIIFNLNDFETKEDMVQATSETR
QHGGDLTNTFGAIEFARNYAYSQTSGGRPGATKVMVVVTDGESHDGSKLKTVIQQCNDDK
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEQIFS
IEGTVQGGDNFQMEMAQVGFSADYTPQNDILMLGAVGAFDWSGTLVQETSHKPVIFPKQA
FDQVLQDRNHSSFLGYSVAAISTENGVHFVAGAPRANYTGQIVLYGVNKQGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPTYMNDLKKEEGKVYLFTITKGILNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSDGAFRSHLQFFGRSLDGYGDLNGDSITDVSIGALGQVIQLWSQSIADVSIEASFTP
DKITLLNKDAKITLKLCFRAAFRPAGQNSQVAILFNMTLDADGHSSRVTSRGMFRENSER
FLQKNMVVNEVQKCSEHHITIQKPSDVVNPLDLRVDISLENPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVQQLPAIQTQPFIVSNKNKRLTFSVILKNRGESAYNTVVLA
EFSENLFFASFSMPVDGTEVTCEVGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFKAFSESQETNKADNSVSLTIPLLYDAELHLTRSTNINFYEISSDENAPSVIKS
VEDIGPKFIFSLKVTAGSAPVSMALVTIHIPQYTKEKNPLLYLTGIQTDQAGDISCTAEI
NPLKLPHTASSVSFKSENFRHTKELDCRTTSCSNITCWLKDLHMKAEYVINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMTAGLWKLGFFKRQYKKMGQNPDEMDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgggaccaggacaggcagggggcgcgctcctgctgcggctgctagtgctagttcaaggt
attttgagttgtctggcgtataatgttggcctcccaggagcgaaaatattttccgggcct
tcaagtgaacagtttgggtattcagtgcagcagcttacgaacccacaaggcaactggcta
ctggttggttcaccgtggagtggcttccctgagaaccgaatgggagatgtgtacaagtgc
cctgtggacctacccactgccacctgtgaaaagctgaatctgcaaaattcatcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggcttgaccctcaccaggaatccg
gggaccggaggctttctaacctgtggtcctctctgggcacatcagtgtggaaatcagtat
tatgcaactgggatctgttctgatgttagtccagacttgcagttcttggccagcttttca
cctgcagttcaggcttgcccttccctcgtagatgttgtagttgtatgtgatgaatcaaac
agtatttatccctgggaagcagtaaagaattttttggtaaagtttgtgaaaggcctgcat
atagggcctaaaaagacacaggtggcattaattcagtatgccaatgacccgagaattata
tttaacttgaacgatttcgaaaccaaagaggatatggtccaggccacatctgagacgcgc
caacatggtggggacctcacaaacacctttggagctatcgaatttgcaagaaactacgct
tattcacagacttctggcgggcgcccaggtgctacaaaagtcatggtcgttgtgactgat
ggcgagtcccatgatgggtcgaagctgaaaactgtgatccagcaatgcaatgatgacaag
attctgaggtttggcatagcagttcttgggtatttaaacagaaatgctcttgatactaaa
aatttaatcaaagaaataaaagcaattgctagtactccaacagagagatactttttcaat
gtggctgacgaagcggctcttctggagaaggctggaactctaggggagcaaatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagtcggattc
agtgcagattacactcctcaaaatgatattctgatgttaggtgcagtgggggcttttgac
tggagtggaactcttgtccaggagacatctcacaagcccgtgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaaccacagttcgtttttaggttactctgtggctgca
atttctactgaaaacggtgtccattttgttgctggtgctcctcgagcaaattatactggc
cagatagtgttgtacggcgttaacaagcaaggcaatgtgactgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgctcagttgatgtggataaagac
accattacagatgtgctcctggtaggtgctcctacatacatgaacgacctcaagaaagaa
gagggaaaagtctacctatttaccatcacaaagggcatcttgaatcagcaccagtttctt
gaaggtccggaaggcactggaaatgctcggtttggttcagcaattgcagccctgtcagac
atcaacatggatggctttaatgatgtgattgtcggttcacctgtagagaatgagaactct
ggagctgtgtacatttacaacggtcaccagggtaccattcgcaccaagtactcccagaaa
atccttggatctgatggagcctttaggagccatctccagttctttggaaggtccctggat
ggctatggtgatttaaacggggattccatcactgatgtatccattggtgctttggggcaa
gtgattcaactctggtcacaaagcattgctgacgtttccatagaagcttcgttcactcca
gacaaaatcactttgctcaacaaggatgctaagataaccctaaagctctgcttcagagca
gcatttagacctgctgggcaaaacagtcaagtagccatcctgtttaacatgacacttgat
gcggacggacattcatccagggtaacctccagggggatgttcagagaaaacagtgagaga
ttcttgcagaagaatatggtggtaaacgaagtgcagaagtgttctgagcaccacattacc
atacagaagccctctgatgttgtcaaccctttggatctgcgtgtggacatcagtttggaa
aacccaggcactagccctgcccttgaagcctattctgaaactgtcaaagtcttcagtatc
cctttctataaggagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
caacagctgccagccattcaaactcaaccctttattgtcagtaacaaaaacaaaaggtta
acattttcagtcatcctgaaaaacagaggggaaagcgcgtacaacactgtggtcctggct
gagttttctgagaacttgttttttgcttctttctccatgccggtcgatggaacagaagta
acatgtgaggttggttcatcgcagaaatctgttacctgtgatgtgggataccctgcctta
aagagtgaacagcaggtgacgtttaccattaacttcgactttaatcttcaaaacctccag
aaccaggcggccatcaatttcaaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagtctcacgattcctctcctgtatgatgctgaacttcacttaacccgatcc
accaacatcaacttctatgagatctcttcggatgagaacgctccttctgtcatcaagagt
gttgaagatattggtcctaaattcatcttctccctcaaggtaacagcaggaagtgctcca
gtgagcatggcattggtgaccattcacattcctcagtacaccaaggaaaagaatccactc
ctgtatctgactgggatacaaacagaccaggctggtgacatcagctgcacagcagaaata
aatccactcaagctaccacacaccgcctcttctgtatctttcaagagtgaaaacttccgg
catacgaaagaattggactgcagaaccacttcctgcagtaacatcacctgctggctgaaa
gaccttcacatgaaagcagagtacgttatcaacgtgacaaccagagtttggaacaggacc
tttgctgcttcgactttccagactgtgcagctgacagcagcagcagagatcgatacacat
aaccctcagctcttcgtgattgaggaaaatgctgtcacgattcccctcatgataatgaaa
cccacggagaaagcagaagtaccgacaggggttatcataggaagcataattgcgggaatc
cttttgctgttggcgatgactgcaggtttgtggaagctcggcttcttcaaaagacaatat
aagaaaatgggccaaaatccagatgaaatggatgagaccacagaactcaacagctaa

KEGG   Mus caroli (Ryukyu mouse): 110311058
Entry
110311058         CDS       T05910                                 

Gene name
Itgav
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04514  Cell adhesion molecules
mcal04810  Regulation of actin cytoskeleton
mcal04919  Thyroid hormone signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110311058 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110311058 (Itgav)
   04514 Cell adhesion molecules
    110311058 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110311058 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311058 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110311058 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110311058 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311058 (Itgav)
   05205 Proteoglycans in cancer
    110311058 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110311058 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110311058 (Itgav)
   05410 Hypertrophic cardiomyopathy
    110311058 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110311058 (Itgav)
   05414 Dilated cardiomyopathy
    110311058 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110311058 (Itgav)
   05165 Human papillomavirus infection
    110311058 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110311058 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110311058 (Itgav)
   04515 Cell adhesion molecules [BR:mcal04515]
    110311058 (Itgav)
   04090 CD molecules [BR:mcal04090]
    110311058 (Itgav)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110311058 (Itgav)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110311058 (Itgav)
  Exosomal proteins of epithelial cells
   110311058 (Itgav)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110311058 (Itgav)
CD molecules [BR:mcal04090]
 Proteins
  110311058 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 110311058
NCBI-ProteinID: XP_021039947
Ensembl: MGP_CAROLIEiJ_G0023714
UniProt: A0A6P5R5P5
LinkDB
Position
2
AA seq 1046 aa
MAAPGWLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPST
SSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRTKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVNSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTVAAAAGQGERNHLITKRDLTLREGDVHTL
GCGIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFP
YKNLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFK
RVRPPQEEQEREQLQPHENGEGNSET
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggctgctcccgggtggctgctgctacgccctcgccccggcggcctcctgctgctgctg
ccgggtctcctgctgcccctcgccgatgccttcaacctggacgtcgaaagtcccgccgag
tatgcgggtcccgagggaagttacttcggattcgccgtggacttcttcgagcccagcacg
tcctccagaatgtttctcctggtgggagcccccaaagcaaacacgacccagcctgggatt
gtagaaggagggcaagttctcaaatgtgaatgctcatccagccgccggtgccagcccatt
gagtttgattcaacaggcaaccgagattatgccaaagatgacccactggagtttaagtcc
caccagtggtttggagcctctgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggacggcacaaagaccgttgagtatgctccatgcaggacaaaaaatattgatgctgat
ggccagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
ctcggtggtcctggtagcttttattggcaaggtcagctcatttccgaccaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaattagcaaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtctcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctctttacacaattttactggtgaa
cagatggctgcatattttggattttctgtagctgctactgacattaatggggatgattat
gcagatgtgtttattggagccccgctgttcatggaccgaggttctgatgggaaactccag
gaggtcggccaggtctcagtgtctctgcagagagcagtgggagacttccagactacaaag
ctgaacggctttgaggtttttgccaggtttggaagtgccatagctccattgggagacctg
gaccaggatggcttcaatgatattgcaattgctgctccatatggtggtgaagataaaaag
ggacttgtttatatcttcaatggaagatccacaggcttgaattcggtgccatctcaaatc
ctcgaggggcagtgggctgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagacaggaatggatatccagacttagttgtaggagcttttggtgtggat
cgagctgtcttatacagagccagacccgttgtcacggtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataagatctgcccgttgcctgggacagctctcaaggtt
tcctgttttaatgtcagattctgcttaaaggcagacggcaagggaacccttccacgcaag
ctcaacttccaggtggagcttctattggataaactcaagcagaagggagccatccgacga
gcactgtttctccataacaggtccccgggccactccaagaccatgactgttttcaggggg
ggacagatgcagtgtgaggaactggtcgcttatcttcgggatgaatctgaatttagagac
aagctcactcccatcaccatttttatggagtatcggttggaccagagaacagctgctgat
gccacaggcttgcagcccatcctgaaccagtttactccggccaacgtcagtcggcaggct
catattctacttgactgtggtgaagacaatgtctgtaaacctaaactggaagtttctgta
aatagtgatcaaaagaagatctatattggggacgacaaccctctgacactgactgtgaag
gcgcagaatcaaggggaaggcgcctatgaagctgagctcatcgtttccatcccgccgcag
gccgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaactcggcaggtggtgtgcgaccttggaaacccgatgaaggctgga
actcaactgctcgctggccttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaagtttgacttgaaaatccagagctctaattcttttgacaatgtaagtccagttgtg
tcttacaaggttgacctcgccgttttggctgctgtggagataagaggagtttcaagtcca
gatcatatctttcttccaattccaaattgggagtacaaggaaaaccctgagactgaagaa
gacgttgggcctattgttcagcacatatacgagctgagaaacaatggtccaagttcattc
agcaaggcaattctaaatctccagtggccttacaaatacaacaacaacactctgttgtac
attcttcattacgacattgacgggccaatgaactgcacggcagatacagagatcaaccct
ttgagaatcaagacacccgaaaagaatgacacagtggcggcagcggcgggacagggagaa
aggaatcatctcatcaccaagcgagatctcaccctcagagagggagatgttcacactttg
ggctgtggaatcgctaagtgcttgcagatcacctgccaggttggtcgactggatagaggc
aagagcgcaatcctgtacgtgaaatccctgctgtggaccgagacgttcatgaacaaggaa
aaccagaaccattcctattccctgaagtcatccgcttcctttaatatcatagaattccct
tacaagaacctgccaattgaggatctcttcaactctacactagtcaccactaacatcacc
tggggcattcagccggcgcccatgccagtgcctgtgtgggtgatcatcttggcagttctc
gcagggctgctcctactggctgtgttggtatttgtaatgtacaggatgggctttttcaaa
cgtgtccgaccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaatggc
gaaggaaactctgaaacctaa

DBGET integrated database retrieval system