KEGG   Mus caroli (Ryukyu mouse): 110285570
Entry
110285570         CDS       T05910                                 

Gene name
Sufu
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04340  Hedgehog signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110285570 (Sufu)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285570 (Sufu)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110285570 (Sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 110285570
NCBI-ProteinID: XP_021007485
Ensembl: MGP_CAROLIEiJ_G0023037
UniProt: A0A6P5P4Z0
LinkDB
Position
19
AA seq 485 aa
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEGLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcgtcgcccccggtcccgccgcgcccccggcctctggccct
agtgcccctccggcctttgcttcactctttcccccgggactgcacgccatctacggagag
tgtcgccgcctctaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggtccggaccccttggactatgttagcatgtacaggaacatggggagtcct
tctgccaacatccctgagcactggcactacatcagctttggcctgagtgatctctatggt
gacaacagagtccatgagtttacaggaacagacggaccaagtggatttggctttgagttg
acatttcgtctgaagagagaaactggggagtctgccccaccaacatggccagcagagctg
atgcagggcctagcccgatatgtcttccagtcagagaacaccttctgtagcggggaccac
gtgtcttggcacagccctttggataacagtgaatcaagaattcagcacatgctgctgaca
gaggacccacagatgcagcctgtgcggacaccctttggggtagtgactttcctccagatt
gttggtgtctgcactgaggagttacactcagcccagcagtggaacgggcagggcatcctg
gaactgctacggacagtacccattgctggcggtccctggctgataactgacatgcggcgg
ggagaaaccatatttgagatcgatccgcacctgcaacaggagagagttgacaaaggcatt
gagacagacggttctaacctgagcggcgtcagtgccaagtgtgcctgggatgacctcagc
cggcctccggaggacgaagaggatagccggagcatctgcctcggcacacagcctcggagg
ctgtctggcaaagacacagagcagatccgggagaccctgaggcggggactggagattaac
agcaaacctgtccttccaccaatcaattcccagcgacagaacggcctcacccacgacagg
gctccgagccgcaaggacagcttgggcagcgacagctccacagccatcatcccccacgag
ctgatccgcacacggcagctcgagagcgtgcatctaaaatttaaccaggagtctggagcc
ctcatccctctctgcctaaggggcagactcctgcatggccggcacttcacctacaagagt
atcacaggcgacatggccatcacgtttgtgtccacaggagtggaaggtgcctttgccact
gaggaacacccatatgcagctcatggaccctggttacaaattctgttgacagaagagttt
gtggagaagatgttggaggacttagaaggtctaacgtctccagaggaatttaaacttccc
aaagagtacagctggcctgagaagaaactcaaagtgtccattctccccgacgtggtgttc
gacagtccgctgcactag

DBGET integrated database retrieval system