KEGG   Mus caroli (Ryukyu mouse): 110285613
Entry
110285613         CDS       T05910                                 

Gene name
Men1
Definition
(RefSeq) menin isoform X1
  KO
K14970  menin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04934  Cushing syndrome
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110285613 (Men1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110285613 (Men1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110285613 (Men1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     110285613 (Men1)
SSDB
Motif
Pfam: Menin
Other DBs
NCBI-GeneID: 110285613
NCBI-ProteinID: XP_021007552
Ensembl: MGP_CAROLIEiJ_G0022605
UniProt: A0A6P5NZ56
LinkDB
Position
19
AA seq 617 aa
MPPPAAMGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVI
PTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSS
RELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVH
LALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKM
EVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPG
RPDPLTLYHKGIASAKTYYQDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYC
REDEEIYKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQGSALQDPECFAHLL
RFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVHIVSREAEAAEAEEPWGDE
AREGRRRGPRRESKPEEPPPPKKPALDKGPGSGQSAGSGPPRKTSGTVPGTTRGGQEVVN
AAQAPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVS
TPSDYTLSFLKRQRKGL
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgccaccgcccgccgccatggggctgaaggccgcccagaagacgctgttccctctgcgc
tctatcgacgacgtggtgcgcctgtttgctgcagagctgggccgagaggagcctgacctg
gtgctcctgtccttggtcctgggcttcgtggagcatttcctggctgtcaaccgtgtcatc
cccaccaacgtgcccgagctcaccttccagcccagccccgcacccgaccctcctggcggc
ctcacctacttcccggtggccgacctatccatcattgctgccctctatgcccgattcacc
gctcagatccgcggcgctgtggacctctccctctatcctcgagaggggggtgtttctagt
cgcgaactggtaaaaaaggtctcggatgtcatatggaacagcctcagccgctcctacttc
aaggaccgggcccacatccagtccctcttcagcttcatcacaggcaccaaactggacagc
tcgggcgtggcctttgcagtggtaggggcctgccaggctctgggtctcagagatgtccat
ctggccctgtctgaggatcatgcttgggtggtgtttgggcccaacggggagcagacagct
gaggtgacgtggcacggcaaaggcaacgaggaccgcagaggccagacagtcaatgccggt
gtggctgagcggagttggctctacctgaaggggtcgtatatgcgctgtgaccgtaagatg
gaggtggcgttcatggtgtgtgccatcaacccttccatcgatcttcacactgactctttg
gaactgttgcaactacagcagaagctgctctggctgctctatgacctcggacatctggaa
agataccccatggcgctagggaacttggcagacctggaggaactggagcctaccccgggt
cggccagacccactcaccctttatcacaagggaattgcctcggctaagacctactaccag
gatgaacacatctacccctacatgtacctggctggctaccactgtcgcaaccgaaatgtg
cgcgaagccctgcaggcctgggctgacactgccactgttatccaagactacaactactgc
cgggaggatgaggagatctacaaggaattctttgaagtggccaatgacgtcatccccaac
ctgctgaaggaggcagccagcctgctagaaacaggcgaagagcggactggggagcaagcc
cagggcacccagggccaaggttctgctctccaggacccagaatgctttgcccacctgctg
cgattttatgatggtatctgcaaatgggaggaaggtagccccacaccagtactgcacgta
ggctgggcaactttccttgtgcagtccctaggccgcttcgagggacaggtgcggcagaag
gtgcacatagttagccgggaagcagaggcggccgaggctgaagaaccatggggggatgaa
gcccgagaaggccgtcggcgtggtccccgcagagagtccaagcctgaagagccaccacca
cccaagaagcctgcattggacaagggcccgggctcaggacaaagtgcagggtcgggacca
cctaggaaaacgtcagggactgtcccaggtactacccgcggtggccaggaagtcgtcaat
gctgctcaggctccagcacctgcagcatcgccacccccagagggcccagtgctcactttc
cagagtgagaagatgaaaggcatgaaggagctactggtggccaccaagatcaactcgagc
gccatcaagctgcagctcacggcacaatcgcaagtgcagatgaagaaacagaaagtgtcc
acacccagcgactacacactctctttcctaaagcggcagcgcaagggcctctga

DBGET integrated database retrieval system