KEGG   Mus caroli (Ryukyu mouse): 110285614
Entry
110285614         CDS       T05910                                 

Gene name
Creb1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04380  Osteoclast differentiation
mcal04612  Antigen processing and presentation
mcal04668  TNF signaling pathway
mcal04710  Circadian rhythm
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110285614 (Creb1)
   04024 cAMP signaling pathway
    110285614 (Creb1)
   04022 cGMP-PKG signaling pathway
    110285614 (Creb1)
   04151 PI3K-Akt signaling pathway
    110285614 (Creb1)
   04152 AMPK signaling pathway
    110285614 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110285614 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    110285614 (Creb1)
   04922 Glucagon signaling pathway
    110285614 (Creb1)
   04915 Estrogen signaling pathway
    110285614 (Creb1)
   04926 Relaxin signaling pathway
    110285614 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    110285614 (Creb1)
   04918 Thyroid hormone synthesis
    110285614 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110285614 (Creb1)
   04916 Melanogenesis
    110285614 (Creb1)
   04924 Renin secretion
    110285614 (Creb1)
   04925 Aldosterone synthesis and secretion
    110285614 (Creb1)
   04927 Cortisol synthesis and secretion
    110285614 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110285614 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110285614 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    110285614 (Creb1)
   04728 Dopaminergic synapse
    110285614 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110285614 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    110285614 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110285614 (Creb1)
   04713 Circadian entrainment
    110285614 (Creb1)
   04714 Thermogenesis
    110285614 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110285614 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110285614 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110285614 (Creb1)
   05020 Prion disease
    110285614 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    110285614 (Creb1)
   05031 Amphetamine addiction
    110285614 (Creb1)
   05034 Alcoholism
    110285614 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110285614 (Creb1)
   04934 Cushing syndrome
    110285614 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110285614 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110285614 (Creb1)
   05161 Hepatitis B
    110285614 (Creb1)
   05163 Human cytomegalovirus infection
    110285614 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110285614 (Creb1)
   05165 Human papillomavirus infection
    110285614 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110285614 (Creb1)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110285614 (Creb1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110285614 (Creb1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    110285614 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 110285614
NCBI-ProteinID: XP_021007594
Ensembl: MGP_CAROLIEiJ_G0014207
UniProt: A0A6P5NW96
LinkDB
Position
1
AA seq 327 aa
MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaaatcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagccgctcacgcgacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcggcccagccatcagttatccagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcgcaggagtct
gtggatagtgtaactgattcccaaaagcgaagggagatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aagtcagaggaggagacttcagcgcctgccatcaccactgtaacagtgccaacccccatt
taccaaacgagcagtgggcagtacattgccattacccagggaggagcaatacagctggct
aacaatggtacggatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacagtatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctcaggcgatgtacaaacataccagatc
cgcacagcacccacgagcaccattgcccctggagttgttatggcatcctccccagcactt
cctacacagcctgctgaagaagcagcacggaagagagaggttcgtctaatgaagaacagg
gaggcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaatcaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

KEGG   Mus caroli (Ryukyu mouse): 110286367
Entry
110286367         CDS       T05910                                 

Gene name
Atf2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110286367 (Atf2)
   04668 TNF signaling pathway
    110286367 (Atf2)
   04022 cGMP-PKG signaling pathway
    110286367 (Atf2)
   04151 PI3K-Akt signaling pathway
    110286367 (Atf2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110286367 (Atf2)
   04922 Glucagon signaling pathway
    110286367 (Atf2)
   04915 Estrogen signaling pathway
    110286367 (Atf2)
   04926 Relaxin signaling pathway
    110286367 (Atf2)
   04935 Growth hormone synthesis, secretion and action
    110286367 (Atf2)
   04918 Thyroid hormone synthesis
    110286367 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    110286367 (Atf2)
   04925 Aldosterone synthesis and secretion
    110286367 (Atf2)
   04927 Cortisol synthesis and secretion
    110286367 (Atf2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110286367 (Atf2)
  09156 Nervous system
   04728 Dopaminergic synapse
    110286367 (Atf2)
  09149 Aging
   04211 Longevity regulating pathway
    110286367 (Atf2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110286367 (Atf2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110286367 (Atf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    110286367 (Atf2)
  09165 Substance dependence
   05030 Cocaine addiction
    110286367 (Atf2)
   05031 Amphetamine addiction
    110286367 (Atf2)
   05034 Alcoholism
    110286367 (Atf2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110286367 (Atf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110286367 (Atf2)
   05161 Hepatitis B
    110286367 (Atf2)
   05163 Human cytomegalovirus infection
    110286367 (Atf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110286367 (Atf2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    110286367 (Atf2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 110286367
NCBI-ProteinID: XP_021008407
Ensembl: MGP_CAROLIEiJ_G0023663
UniProt: A0A6P5P797
LinkDB
Position
2
AA seq 487 aa
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDSVKGHGSGLVRTQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPS
QAQPSGS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacgccaacaagattcctaaaaaac
tgtgaagaagtgggtttgttcaatgagttggcaagtccatttgaaaatgaattcaagaag
gcttccgaagatgacattaaaaaaatgcctctagatttgtcccctcttgcaacacccatc
ataagaagcaaaattgaggagccttctgttgtagaaacaactcaccaggacagcccttta
cctcaccccgagtcgactaccagtgatgaaaaggaagtaccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccctcctctaacaggccaattgttcctgtaccaggcccatttcctcttctc
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccagtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatagtgtaaaaggccat
ggcagtggattggttaggactcagtcagaagagtctcgtccacagtccttgcagcagcca
gccacctccactacagaaactccggcttctccagctcacacaactccacagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtatgggtccag
tccttagagaagaaagcagaagacttgagttcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcccagctgaaacagcttcttctggctcataaagattgc
cctgtaactgccatgcagaagaagtctggctatcatactgctgataaagatgacagttca
gaagacctttctgtgccaagcagtccacatacagaagcgatccagcacagctctgtcagc
acatccaatggagtcagttcaacatcaaaagcagaagctgtagccacttcagtcctcacc
cagatggcggaccagagcacggagcctgcactttcacagattgtcatggctcctccctcc
caggcacagccctcaggaagttga

KEGG   Mus caroli (Ryukyu mouse): 110289497
Entry
110289497         CDS       T05910                                 

Gene name
Creb3l1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110289497 (Creb3l1)
   04024 cAMP signaling pathway
    110289497 (Creb3l1)
   04022 cGMP-PKG signaling pathway
    110289497 (Creb3l1)
   04151 PI3K-Akt signaling pathway
    110289497 (Creb3l1)
   04152 AMPK signaling pathway
    110289497 (Creb3l1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110289497 (Creb3l1)
   04922 Glucagon signaling pathway
    110289497 (Creb3l1)
   04915 Estrogen signaling pathway
    110289497 (Creb3l1)
   04926 Relaxin signaling pathway
    110289497 (Creb3l1)
   04935 Growth hormone synthesis, secretion and action
    110289497 (Creb3l1)
   04918 Thyroid hormone synthesis
    110289497 (Creb3l1)
   04928 Parathyroid hormone synthesis, secretion and action
    110289497 (Creb3l1)
   04916 Melanogenesis
    110289497 (Creb3l1)
   04925 Aldosterone synthesis and secretion
    110289497 (Creb3l1)
   04927 Cortisol synthesis and secretion
    110289497 (Creb3l1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110289497 (Creb3l1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110289497 (Creb3l1)
  09156 Nervous system
   04725 Cholinergic synapse
    110289497 (Creb3l1)
   04728 Dopaminergic synapse
    110289497 (Creb3l1)
  09149 Aging
   04211 Longevity regulating pathway
    110289497 (Creb3l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110289497 (Creb3l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110289497 (Creb3l1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110289497 (Creb3l1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110289497 (Creb3l1)
   05020 Prion disease
    110289497 (Creb3l1)
  09165 Substance dependence
   05030 Cocaine addiction
    110289497 (Creb3l1)
   05031 Amphetamine addiction
    110289497 (Creb3l1)
   05034 Alcoholism
    110289497 (Creb3l1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110289497 (Creb3l1)
   04934 Cushing syndrome
    110289497 (Creb3l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110289497 (Creb3l1)
   05161 Hepatitis B
    110289497 (Creb3l1)
   05163 Human cytomegalovirus infection
    110289497 (Creb3l1)
   05165 Human papillomavirus infection
    110289497 (Creb3l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110289497 (Creb3l1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110289497 (Creb3l1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 Jnk-SapK_ap_N DUF4337 TPR_MLP1_2 ELP6 APG6_N ADIP HAUS-augmin3 JMY DUF724 JIP_LZII
Other DBs
NCBI-GeneID: 110289497
NCBI-ProteinID: XP_021011382
Ensembl: MGP_CAROLIEiJ_G0023974
UniProt: A0A6P5PEJ0
LinkDB
Position
2
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFVENMEDFSNDLFSSFFD
DPVLDEKSALLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPVKMEDTTQDVEHGAWALG
NKLCSIMVKQEQSPELPVDPLAASSAMAAAAAMATPPLLGLSPMPRLPIPHQAPGEMTQL
PVIKAEPPEMSQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPAFSSGSMTVKEDPIAADSVYAASQM
PSRSLLFYDDGAGSWEDGRGALLPVEPPEGWELKPGGPAEQRPQDHLRHDRADSIHETTK
YLRETWPEDTDDNGTSPNFSHPKEWFHDRDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaacctttcccggccgacaggctgttcccgggatccagcttcctg
gacttgggagacctgaatgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgtggagaacatggaggacttctccaatgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagtgctctgctggacatggaactggactcccctgctcca
ggcatccaggcggagcacagctactccctgagtggggattctgcaccccagagccccctt
gtgcctgtcaagatggaggacaccacccaagatgtggaacacggagcgtgggccctggga
aacaagctgtgctccatcatggtgaagcaggagcagagcccggagctgcctgtagatccc
ctggctgcctcttctgccatggctgctgccgccgccatggccaccccaccactgctgggc
ctcagccccatgccccggctgcccatccctcaccaggccccaggagaaatgactcagctg
ccagtgatcaaagcagagcccccagaaatgagccagtttctcaaagtgacaccagaggac
ctcgtacagatgcctccaacaccccccagcagccatggcagtgacagtgacggctcccag
agtccccgctctcttcccccctccagccctatccggcccatggcccgctcctccacggcc
atttccacctctccgctcctcactgcccctcacaaactgcaggggacatcagggccactg
ctcttgacagaagaggagaagcggaccttgatcgcagagggttaccctatccccaccaag
ctccccctcaccaaggctgaggagaaggccttgaagagagtacgcaggaaaattaagaac
aagatttctgcccaggagagccgccgcaagaagaaggagtatgtagaatgtctagaaaag
aaggtggagacatatacatcagagaacaatgagctgtggaagaaagtggaaaccctagag
actgccaacaggaccctgctccaacagctgcagaaactccagactctggtcaccagcaag
atctccagaccgtacaagatggcagccacgcagaccggcacctgtctcatggtggcagcc
ttgtgcttcgtcctggtgctgggctcccttgtgccctgccttcctgcattctcttccggc
tcaatgactgtgaaagaagatcctatcgcagctgacagcgtctacgcagccagtcagatg
ccttcccgaagcctactgttctacgatgatggggcaggttcatgggaagatggccgaggt
gctctactgcctgtggagcccccagaaggctgggagctcaaacccgggggtccagcagag
cagaggccccaagaccacctccgacatgaccgtgcagacagcatccatgagaccaccaag
tacttgagagagacctggccagaggacactgatgacaacggcaccagccccaacttctcc
caccccaaggagtggttccatgacagggatctgggccccaacaccaccatcaaactctcc
tag

KEGG   Mus caroli (Ryukyu mouse): 110291408
Entry
110291408         CDS       T05910                                 

Gene name
Creb3l4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110291408 (Creb3l4)
   04024 cAMP signaling pathway
    110291408 (Creb3l4)
   04022 cGMP-PKG signaling pathway
    110291408 (Creb3l4)
   04151 PI3K-Akt signaling pathway
    110291408 (Creb3l4)
   04152 AMPK signaling pathway
    110291408 (Creb3l4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110291408 (Creb3l4)
   04922 Glucagon signaling pathway
    110291408 (Creb3l4)
   04915 Estrogen signaling pathway
    110291408 (Creb3l4)
   04926 Relaxin signaling pathway
    110291408 (Creb3l4)
   04935 Growth hormone synthesis, secretion and action
    110291408 (Creb3l4)
   04918 Thyroid hormone synthesis
    110291408 (Creb3l4)
   04928 Parathyroid hormone synthesis, secretion and action
    110291408 (Creb3l4)
   04916 Melanogenesis
    110291408 (Creb3l4)
   04925 Aldosterone synthesis and secretion
    110291408 (Creb3l4)
   04927 Cortisol synthesis and secretion
    110291408 (Creb3l4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110291408 (Creb3l4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110291408 (Creb3l4)
  09156 Nervous system
   04725 Cholinergic synapse
    110291408 (Creb3l4)
   04728 Dopaminergic synapse
    110291408 (Creb3l4)
  09149 Aging
   04211 Longevity regulating pathway
    110291408 (Creb3l4)
  09159 Environmental adaptation
   04714 Thermogenesis
    110291408 (Creb3l4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110291408 (Creb3l4)
  09162 Cancer: specific types
   05215 Prostate cancer
    110291408 (Creb3l4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110291408 (Creb3l4)
   05020 Prion disease
    110291408 (Creb3l4)
  09165 Substance dependence
   05030 Cocaine addiction
    110291408 (Creb3l4)
   05031 Amphetamine addiction
    110291408 (Creb3l4)
   05034 Alcoholism
    110291408 (Creb3l4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110291408 (Creb3l4)
   04934 Cushing syndrome
    110291408 (Creb3l4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110291408 (Creb3l4)
   05161 Hepatitis B
    110291408 (Creb3l4)
   05163 Human cytomegalovirus infection
    110291408 (Creb3l4)
   05165 Human papillomavirus infection
    110291408 (Creb3l4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110291408 (Creb3l4)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110291408 (Creb3l4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB EMP24_GP25L ATG16 KASH_CCD DUF4407 DUF4200 UPF0242 TMCO5 SOGA DUF2207 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 110291408
NCBI-ProteinID: XP_021014207
Ensembl: MGP_CAROLIEiJ_G0025229
UniProt: A0A6P5PGX1
LinkDB
Position
3
AA seq 365 aa
MELGCPELLEPPEDIFSTGSFLELGFNGPASKGLQKSEPDDFLNLFIDPNMIHCSETSPG
SDSGVSEDPGSPAQQAPSSPALYEVVYDAGTLQGTQQEAEPTFGLISIQIDQWTPAFMVP
DACTVSGLPSDSHRHILPRVSTRAPAPPTAMPSCQHHLFLTDEEKQLLAQEGITLPSHLP
LTKAEERILKKIRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSEQNQKLQRKVQELERQ
NIFLMAQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSLSPFQGQSEARPEDYQL
HGVISRNILTHENETESLESPVLKSKLEELPEAPTTNGSTKTHPKMRVKARPTGQMRGMV
HADEM
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggagctcggatgccctgagttgctggaacccccagaagatatcttctcgacgggatcc
ttcctggagctgggattcaacggtcccgcatcaaagggccttcagaagagtgaacctgac
gatttcctgaacctctttatcgatcccaatatgatacactgctcagaaacatctcctggt
agtgacagtggggtctctgaagatcctggctcccctgcccaacaggctcccagttcccct
gccctctatgaggttgtctatgatgcagggacactacagggaactcagcaggaagctgag
ccaaccttcggactcatctctatccagatagatcagtggacccctgcatttatggtccct
gatgcctgcacagtcagtggactgccctccgattcgcatagacatatcctgcctagggtc
agcaccagagccccagcacctcctacagccatgccgtcctgccaacatcatctgttcctg
acagatgaagaaaagcaactgttggcgcaagaagggattactctgccctctcacctgccc
ctcaccaaggcagaggagagaatactcaagaagatcaggaggaaaatccgcaacaagcag
tcagctcaggacagccggcggcggaagaaagaatacatagatgggctggagagcagagtg
gcagcctgttcggaacagaatcagaaactacagagaaaggtccaggagctggagaggcag
aacatcttcttgatggcacaggtccgccagttacagaagctcactgctcagacctccagc
agagctgcccagaccagcacctgtgttctgattcttcttttttcactggctctcatcatc
ctgcccagtttgagcccctttcagggtcaatcagaagctaggcctgaggattatcagctt
catggagtgatttccagaaatatcttgactcacgagaacgaaacagaaagcctggagagt
ccagtgctaaagtccaaactggaggagctacctgaagccccaactacaaatggttcaaca
aagacacatccgaagatgcgagtgaaggcgagacccactggacagatgaggggaatggtg
catgcagatgagatgtaa

KEGG   Mus caroli (Ryukyu mouse): 110292754
Entry
110292754         CDS       T05910                                 

Gene name
Creb3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110292754 (Creb3)
   04024 cAMP signaling pathway
    110292754 (Creb3)
   04022 cGMP-PKG signaling pathway
    110292754 (Creb3)
   04151 PI3K-Akt signaling pathway
    110292754 (Creb3)
   04152 AMPK signaling pathway
    110292754 (Creb3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110292754 (Creb3)
   04922 Glucagon signaling pathway
    110292754 (Creb3)
   04915 Estrogen signaling pathway
    110292754 (Creb3)
   04926 Relaxin signaling pathway
    110292754 (Creb3)
   04935 Growth hormone synthesis, secretion and action
    110292754 (Creb3)
   04918 Thyroid hormone synthesis
    110292754 (Creb3)
   04928 Parathyroid hormone synthesis, secretion and action
    110292754 (Creb3)
   04916 Melanogenesis
    110292754 (Creb3)
   04925 Aldosterone synthesis and secretion
    110292754 (Creb3)
   04927 Cortisol synthesis and secretion
    110292754 (Creb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110292754 (Creb3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110292754 (Creb3)
  09156 Nervous system
   04725 Cholinergic synapse
    110292754 (Creb3)
   04728 Dopaminergic synapse
    110292754 (Creb3)
  09149 Aging
   04211 Longevity regulating pathway
    110292754 (Creb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110292754 (Creb3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110292754 (Creb3)
  09162 Cancer: specific types
   05215 Prostate cancer
    110292754 (Creb3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110292754 (Creb3)
   05020 Prion disease
    110292754 (Creb3)
  09165 Substance dependence
   05030 Cocaine addiction
    110292754 (Creb3)
   05031 Amphetamine addiction
    110292754 (Creb3)
   05034 Alcoholism
    110292754 (Creb3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110292754 (Creb3)
   04934 Cushing syndrome
    110292754 (Creb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292754 (Creb3)
   05161 Hepatitis B
    110292754 (Creb3)
   05163 Human cytomegalovirus infection
    110292754 (Creb3)
   05165 Human papillomavirus infection
    110292754 (Creb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110292754 (Creb3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110292754 (Creb3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF2721
Other DBs
NCBI-GeneID: 110292754
NCBI-ProteinID: XP_021015957
Ensembl: MGP_CAROLIEiJ_G0025942
UniProt: A0A6P5PJA1
LinkDB
Position
4
AA seq 382 aa
MDPGGQDLLALDPGDQDLLGFLLEESGDLWAAIEPDVKAPLDLELSPSENSVQELSDWEV
EDLLSSLLSPSASRDVLGSSSSSSSSILHDHNYSLPQEHISIDLDTESFEKEGFLVTPLR
GEERAAEQEMSRLILTEEEKSLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQES
RKKKKVYVVGLESRVLKYTAQNRELQNKVQRLEEQNLSLLDQLRKLQAMVIEIANKTSSG
STCVLVLVFSFCLLLVPAMYSSDARGSVPAEYVVLHRKLRALPSEDHHQPKLSDLPSELP
MDSTHQSLDSSEHMFLVSSNFSCVLYHMPQAEQPLHWPLWDLSSEMLFSGSNLLLQANLS
ESEGWQPNHSPSLVILQGRYSG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggatcctggtggtcaggatctgctagctttggaccccggtgatcaggacctgctgggc
tttctgctagaggaaagcggagatttgtgggctgcgattgagccggacgtgaaggctccc
ctggacttggagctgtcaccttccgagaactccgtgcaagaactgagcgactgggaggta
gaggatttactgagctctctgctcagtccctcagcatcgcgggatgttctcggctcttcc
agctcttccagctcttccattctccatgatcacaactactcccttccacaggagcacatc
tccatagatctagatactgagagcttcgaaaaggaggggttcctcgtgactccactgcga
ggggaggaaagagcagcggaacaggagatgtctaggctgatactgaccgaggaagagaaa
tcgcttttggagaaggaggggctcactctgccctcaacccttcctctcactaaggtggag
gaacaagttctgaaacgagtgcggaggaagattcgtaacaagagagcagctcaagaaagc
cgcaagaagaagaaggtgtatgtcgtggggctggagagcagggtcttgaaatacacagct
cagaatcgggagctacagaacaaggtgcagcgtctggaggaacagaatctgtcccttcta
gatcaactgaggaagcttcaagccatggtgattgagatagccaacaaaaccagcagcggc
agcacttgtgttctggtcctcgtgttctccttctgtcttctcctggtacctgctatgtac
tcctctgatgcaaggggaagtgtgcctgcggagtatgttgtgttgcaccgcaagcttcgt
gccctccccagcgaggaccatcatcagccgaagctgtctgacctaccttcagagctaccc
atggacagcacacaccagtcactggatagctcagaacatatgttcttggtctccagcaac
ttttcctgtgtactgtaccacatgcctcaggcagagcagcccctgcactggccactctgg
gatctttcttcagagatgctcttctccggctccaaccttctcctgcaggcaaacctttca
gaaagcgagggatggcaacctaaccacagcccttctttggtcatcttgcagggcaggtat
tcaggttag

KEGG   Mus caroli (Ryukyu mouse): 110296066
Entry
110296066         CDS       T05910                                 

Gene name
Creb3l2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110296066 (Creb3l2)
   04024 cAMP signaling pathway
    110296066 (Creb3l2)
   04022 cGMP-PKG signaling pathway
    110296066 (Creb3l2)
   04151 PI3K-Akt signaling pathway
    110296066 (Creb3l2)
   04152 AMPK signaling pathway
    110296066 (Creb3l2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110296066 (Creb3l2)
   04922 Glucagon signaling pathway
    110296066 (Creb3l2)
   04915 Estrogen signaling pathway
    110296066 (Creb3l2)
   04926 Relaxin signaling pathway
    110296066 (Creb3l2)
   04935 Growth hormone synthesis, secretion and action
    110296066 (Creb3l2)
   04918 Thyroid hormone synthesis
    110296066 (Creb3l2)
   04928 Parathyroid hormone synthesis, secretion and action
    110296066 (Creb3l2)
   04916 Melanogenesis
    110296066 (Creb3l2)
   04925 Aldosterone synthesis and secretion
    110296066 (Creb3l2)
   04927 Cortisol synthesis and secretion
    110296066 (Creb3l2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110296066 (Creb3l2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110296066 (Creb3l2)
  09156 Nervous system
   04725 Cholinergic synapse
    110296066 (Creb3l2)
   04728 Dopaminergic synapse
    110296066 (Creb3l2)
  09149 Aging
   04211 Longevity regulating pathway
    110296066 (Creb3l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110296066 (Creb3l2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110296066 (Creb3l2)
  09162 Cancer: specific types
   05215 Prostate cancer
    110296066 (Creb3l2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110296066 (Creb3l2)
   05020 Prion disease
    110296066 (Creb3l2)
  09165 Substance dependence
   05030 Cocaine addiction
    110296066 (Creb3l2)
   05031 Amphetamine addiction
    110296066 (Creb3l2)
   05034 Alcoholism
    110296066 (Creb3l2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110296066 (Creb3l2)
   04934 Cushing syndrome
    110296066 (Creb3l2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110296066 (Creb3l2)
   05161 Hepatitis B
    110296066 (Creb3l2)
   05163 Human cytomegalovirus infection
    110296066 (Creb3l2)
   05165 Human papillomavirus infection
    110296066 (Creb3l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110296066 (Creb3l2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110296066 (Creb3l2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 110296066
NCBI-ProteinID: XP_021020250
Ensembl: MGP_CAROLIEiJ_G0028225
UniProt: A0A6P5Q136
LinkDB
Position
6
AA seq 521 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SESMEVEPSPTSPAPLIQAEHSYSLSEEPRTQSPFTHAATSDSFNDEEVESEKWYLSTEF
PSATIKTEPITEEQPPGLVPSVTLTITAISTPFEKEESPLDMNAGGDASCQTLIPKIKLE
PHEVDQFLNFSPKEASVDQLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLSQAHSPARAMP
RGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGGFFQGYGPYPSATKMALPSQHPLSEPYT
ASVVRSRNLLIYEEHAPLEESSSPASAGELGGWDRGSSLLRASSGLEALPEVDLPHFIIS
NETSLEKSVLLELQQHLVSSKLEGNETLKVVELERRVNATF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggagagactgaggccctcatgtaccacacgcacttctcggagctcctg
gacgagttttcccagaatgtcctgggtcagctcctgaatgaccctttcctctcagagaag
agcgagtcaatggaggtggagccatctccaacatcaccagcgcctctcatccaggctgaa
catagctactctctgagcgaggagccccggactcagtcaccatttacccatgcggctacc
agcgacagcttcaatgacgaggaggtggagagtgaaaaatggtacctgtctacagagttt
ccttcagctaccatcaagacagagccaatcacagaggagcagcccccaggacttgtccct
tctgtcactctgaccatcacagccatttccactccttttgaaaaagaagagtcccctctg
gatatgaatgctgggggggacgcctcctgccagacgcttatccctaagattaagctggag
ccgcatgaagtggatcagttcttaaacttctctccgaaagaagcctccgtggatcaactg
cacttaccaccaacaccacccagtagccacagcagtgactctgagggcagcttgagcccc
aacccacgcctgcatcccttcagcctgtctcaggcccacagccctgccagagccatgccc
cggggcccctctgccttgtccacatctcctcttctcacagctccacataagctgcaggga
tcgggccccctggtcctgacagaggaggagaagaggaccttggttgccgagggctatccc
attcccaccaagctgcccctgacaaaatctgaggagaaggccctgaagaaaatccggaga
aagatcaagaataagatttctgcccaagaaagcaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggtg
gaggtgctggagaacaccaataggactctccttcagcaacttcagaagcttcagactttg
gtgatggggaaggtctctcgaacctgcaagttagctggcacacagactggcacctgcctc
atggtcgttgtgctttgctttgctgttgcatttggaggcttctttcagggctatgggcct
tatccttctgccaccaagatggctctgcccagccagcatcctctgtcagagccatacaca
gcctccgtggtgagatccaggaacctgctaatctatgaggaacacgctcccctggaagag
tcgtcgagcccagcctcagccggggagctggggggctgggacagaggctcctctctgctc
agggcatcgtccgggcttgaggccctgccagaggtggatcttccccatttcattatctcc
aatgagacgagcttggagaagtcagtactgttggagcttcagcagcacctggtcagcagc
aaactggaagggaatgaaacactcaaggttgtagaactggagaggagagtgaacgccacc
ttctaa

KEGG   Mus caroli (Ryukyu mouse): 110296203
Entry
110296203         CDS       T05910                                 

Gene name
Creb5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110296203 (Creb5)
   04024 cAMP signaling pathway
    110296203 (Creb5)
   04022 cGMP-PKG signaling pathway
    110296203 (Creb5)
   04151 PI3K-Akt signaling pathway
    110296203 (Creb5)
   04152 AMPK signaling pathway
    110296203 (Creb5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110296203 (Creb5)
   04922 Glucagon signaling pathway
    110296203 (Creb5)
   04915 Estrogen signaling pathway
    110296203 (Creb5)
   04926 Relaxin signaling pathway
    110296203 (Creb5)
   04935 Growth hormone synthesis, secretion and action
    110296203 (Creb5)
   04918 Thyroid hormone synthesis
    110296203 (Creb5)
   04928 Parathyroid hormone synthesis, secretion and action
    110296203 (Creb5)
   04925 Aldosterone synthesis and secretion
    110296203 (Creb5)
   04927 Cortisol synthesis and secretion
    110296203 (Creb5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110296203 (Creb5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110296203 (Creb5)
  09156 Nervous system
   04725 Cholinergic synapse
    110296203 (Creb5)
   04728 Dopaminergic synapse
    110296203 (Creb5)
  09149 Aging
   04211 Longevity regulating pathway
    110296203 (Creb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    110296203 (Creb5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110296203 (Creb5)
  09162 Cancer: specific types
   05215 Prostate cancer
    110296203 (Creb5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110296203 (Creb5)
   05020 Prion disease
    110296203 (Creb5)
  09165 Substance dependence
   05030 Cocaine addiction
    110296203 (Creb5)
   05031 Amphetamine addiction
    110296203 (Creb5)
   05034 Alcoholism
    110296203 (Creb5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110296203 (Creb5)
   04934 Cushing syndrome
    110296203 (Creb5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110296203 (Creb5)
   05161 Hepatitis B
    110296203 (Creb5)
   05163 Human cytomegalovirus infection
    110296203 (Creb5)
   05165 Human papillomavirus infection
    110296203 (Creb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110296203 (Creb5)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    110296203 (Creb5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 110296203
NCBI-ProteinID: XP_021020451
Ensembl: MGP_CAROLIEiJ_G0028397
UniProt: A0A6P7RC98
LinkDB
Position
6
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSFEHEFRKAQEEENSKRNISMHNTVGGTMTGPGAHQLGSTRMPNHDS
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPTHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaacttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgtttc
ccaacagaggaccatctgatgattcataggcacaagcatgagatgactttgaagttccct
tcaataaagacagacaatatgctgtcagatcagactccgacacccacgagattcctgaag
aactgtgaagaggtgggtctcttcagtgagctggactgctcctttgagcacgagttcagg
aaggctcaagaggaagagaacagcaagcggaatatctccatgcataatacagttggtggg
accatgacgggacctggagctcaccagctaggcagcactcggatgcccaaccacgacagc
agcgttgtgattcagcaagccatgccttctccccagtccagctcggtcatcactcaggct
ccttccaccaaccgccagattgggcctgtcccaggctctctatcatctctactccatctc
cacaacagacagaggcagcccatgccggcctccatgcctggaaccctgcccaaccccacc
atgccaggatcttctgccgtcttgatgcctatggagagacagatgtcagtgaactccagc
atcatgggcatgcaaggtccaaacctcagcaacccctgtgcttctccccaagtccagcca
atgcattcagaagccaaaatgagactgaaggctgcgctgactcaccatcctgccgccatg
tcgaacgggaacatgagcaccatcggacacatgatggagatgatgggctctcggcaagac
cagacaccgcaccaccacctgcactcacacccgcatcagcaccagacactgccgccccac
cacccctatccacaccagcaccagcaccccacacaccatccccacccacagcctcaccac
cagcagaaccacccgcaccaccactcccattcccaccttcacgcacacccggcgcaccac
cagacctcgccacacccacccctgcacaccggcaaccaagcacaggtttcaccagctaca
caacagatgcagccaacccagacaatacaaccgccccagcccacagggggacgccggcga
agggtggtggatgaggacccagatgagaggcggaggaaatttctggaaaggaaccgggcc
gccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagct
gaagagctcacccagacaaacatgcagcttcagaatgaagtgtccatgttgaaaaatgag
gtggcccagctgaagcagttgttgttaacacataaagactgtccgataacagccatgcag
aaagaatcccaagggtatttaagtccagagagcagccctcctgcgagccctgtgccagca
tgctctcagcagcaagttatccaacacaacaccatcactacatcctcatcggtcagcgag
gtcgtggggagctccaccctcagtcagctcacaactcacagaacagacctgaatcctatt
ctttaa

KEGG   Mus caroli (Ryukyu mouse): 110303337
Entry
110303337         CDS       T05910                                 

Gene name
Creb3l3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04714  Thermogenesis
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04931  Insulin resistance
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110303337 (Creb3l3)
   04024 cAMP signaling pathway
    110303337 (Creb3l3)
   04022 cGMP-PKG signaling pathway
    110303337 (Creb3l3)
   04151 PI3K-Akt signaling pathway
    110303337 (Creb3l3)
   04152 AMPK signaling pathway
    110303337 (Creb3l3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110303337 (Creb3l3)
   04922 Glucagon signaling pathway
    110303337 (Creb3l3)
   04915 Estrogen signaling pathway
    110303337 (Creb3l3)
   04926 Relaxin signaling pathway
    110303337 (Creb3l3)
   04935 Growth hormone synthesis, secretion and action
    110303337 (Creb3l3)
   04918 Thyroid hormone synthesis
    110303337 (Creb3l3)
   04928 Parathyroid hormone synthesis, secretion and action
    110303337 (Creb3l3)
   04916 Melanogenesis
    110303337 (Creb3l3)
   04925 Aldosterone synthesis and secretion
    110303337 (Creb3l3)
   04927 Cortisol synthesis and secretion
    110303337 (Creb3l3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110303337 (Creb3l3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110303337 (Creb3l3)
  09156 Nervous system
   04725 Cholinergic synapse
    110303337 (Creb3l3)
   04728 Dopaminergic synapse
    110303337 (Creb3l3)
  09149 Aging
   04211 Longevity regulating pathway
    110303337 (Creb3l3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110303337 (Creb3l3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110303337 (Creb3l3)
  09162 Cancer: specific types
   05215 Prostate cancer
    110303337 (Creb3l3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110303337 (Creb3l3)
   05020 Prion disease
    110303337 (Creb3l3)
  09165 Substance dependence
   05030 Cocaine addiction
    110303337 (Creb3l3)
   05031 Amphetamine addiction
    110303337 (Creb3l3)
   05034 Alcoholism
    110303337 (Creb3l3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110303337 (Creb3l3)
   04934 Cushing syndrome
    110303337 (Creb3l3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110303337 (Creb3l3)
   05161 Hepatitis B
    110303337 (Creb3l3)
   05163 Human cytomegalovirus infection
    110303337 (Creb3l3)
   05165 Human papillomavirus infection
    110303337 (Creb3l3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303337 (Creb3l3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110303337 (Creb3l3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Spc29 DUF724 ADIP
Other DBs
NCBI-GeneID: 110303337
NCBI-ProteinID: XP_021030093
Ensembl: MGP_CAROLIEiJ_G0015618
UniProt: A0A6P5QJK7
LinkDB
Position
10
AA seq 479 aa
MDGDIATGKMASPVCAMAPLDSMEVLDLLFDRQDGILRNMELAEGWILAREEQKVLLNSD
SDEFLNCILGPGDSDPSSPLWSPADSDSGISEDLPSDPQDTPPRSGTEPANTVARCHTSE
QGKGPCPSYLPSTPCPEPPRTQVQESSVAIDLDMWSTDTLYLEEPTGSPSRFNLTVKELL
LSGGSGDLQQHSLAASQLLGPGSGHCQELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
HLQALVVQSTSKPAHAGTCIAVLLLSFALIILPSISPFNSNKVDSPGDFVPVRVFSRTLH
NHAASRVAPDVTPGSEVPGPWPDVGTPHKGPSSGGLSADWGNFLEIPMLDNPTEELDNST
LVLANSTEDLGRATLLDWVASEPLLSPARVGLEMPGEMWLSWVPRWLRVRVVQDALGVL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatggggacatagcgactggaaagatggcgtcccctgtctgtgctatggcgcccttg
gacagcatggaagtccttgacctcctgtttgatcggcaggatggcatcctgagaaacatg
gagctggccgagggctggatcctcgccagagaggagcagaaagttctactaaattctgac
tctgatgaattcctaaattgcattctgggacctggagactctgatcccagctccccatta
tggtcccccgctgatagtgacagtggcatctctgaggatctaccttcagacccccaggac
acccctcctcgtagtggcaccgaaccagccaacacggtagccaggtgtcacaccagtgag
caaggcaaggggccctgcccctcctatctgcccagcaccccatgccctgagcctccaagg
acacaagtccaggagtcctcagtggccattgacctggacatgtggagcacagacaccctg
tacctggaggagccgactggctcgccctcccgcttcaacctcactgtgaaggaactgctg
ctgtccggtggcagcggggacttgcaacagcattccttggctgcctcccagctgctggga
cctgggagtgggcactgccaggagctggtgctgacagaggatgagaagaagctgctggct
aaagagggggtgaccctacccacccagctgcctctcaccaagtatgaggaacgagtgttg
aaaaaaatccgcagaaagatccggaacaagcagtcggctcaagaaagcaggaagaagaaa
aaagaatacattgatggtctggagaaccggatgtcagcatgtactgcccagaaccaggag
ctgcagaggaaggttttgcatttagaaaagcaaaatttgtctcttctggagcagctgaaa
cacctgcaggcacttgtggtccagtcaaccagcaagccagcccatgcaggcacctgcata
gcggtccttctgctgtccttcgccctgatcatcctcccctccatcagccctttcaactcc
aacaaagtcgacagccctggagacttcgtgccagtgcgagtgttttccagaaccctccac
aaccacgctgcatcccgagtggctcccgatgtcaccccaggatctgaggtcccaggacct
tggcccgacgttggtaccccccacaaaggcccttcttccggtggcctcagtgcagactgg
ggtaattttctggaaattccaatgttggacaacccaacagaagagctagacaactccacc
ctggtgctggccaactccacagaggacctgggacgggccaccctgctggactgggtggct
tcagaaccactgctcagcccggcccgggttgggctggagatgccaggggagatgtggctg
tcctgggtaccaaggtggcttagggtccgcgtggtacaagatgctttgggggtgctgtga

KEGG   Mus caroli (Ryukyu mouse): 110310868
Entry
110310868         CDS       T05910                                 

Gene name
Atf4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04137  Mitophagy - animal
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04922  Glucagon signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04932  Non-alcoholic fatty liver disease
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110310868 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110310868 (Atf4)
   04668 TNF signaling pathway
    110310868 (Atf4)
   04022 cGMP-PKG signaling pathway
    110310868 (Atf4)
   04151 PI3K-Akt signaling pathway
    110310868 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110310868 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    110310868 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110310868 (Atf4)
   04922 Glucagon signaling pathway
    110310868 (Atf4)
   04912 GnRH signaling pathway
    110310868 (Atf4)
   04915 Estrogen signaling pathway
    110310868 (Atf4)
   04926 Relaxin signaling pathway
    110310868 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    110310868 (Atf4)
   04918 Thyroid hormone synthesis
    110310868 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    110310868 (Atf4)
   04925 Aldosterone synthesis and secretion
    110310868 (Atf4)
   04927 Cortisol synthesis and secretion
    110310868 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110310868 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    110310868 (Atf4)
   04728 Dopaminergic synapse
    110310868 (Atf4)
   04720 Long-term potentiation
    110310868 (Atf4)
   04722 Neurotrophin signaling pathway
    110310868 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    110310868 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110310868 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    110310868 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110310868 (Atf4)
   05012 Parkinson disease
    110310868 (Atf4)
   05014 Amyotrophic lateral sclerosis
    110310868 (Atf4)
   05020 Prion disease
    110310868 (Atf4)
   05022 Pathways of neurodegeneration - multiple diseases
    110310868 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    110310868 (Atf4)
   05031 Amphetamine addiction
    110310868 (Atf4)
   05034 Alcoholism
    110310868 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110310868 (Atf4)
   04934 Cushing syndrome
    110310868 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110310868 (Atf4)
   05161 Hepatitis B
    110310868 (Atf4)
   05163 Human cytomegalovirus infection
    110310868 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310868 (Atf4)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    110310868 (Atf4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF4795 Fez1 Laminin_II DUF3450 AAA_13
Other DBs
NCBI-GeneID: 110310868
NCBI-ProteinID: XP_021039656
Ensembl: MGP_CAROLIEiJ_G0020037
UniProt: A0A6P5R7E4
LinkDB
Position
15
AA seq 349 aa
MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
AMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCD
LFAPLVQETNKEPPQTVNPIGHLPESVIKVDQVAPFTFLQPFPCSPGVLSSTPDHSFSLE
LGSEVDISEGDRKLDSAAYITLIPQCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRA
PPDNLPSPGGPRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAE
QEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaagtgttggcgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactatctggaggtg
gccaagcacttgaaacctcatgggttctccagcgacaaggcgggctcctcggaatggccg
gctatggatgatggcttggccagtgcctcagacaccggcaaggaggatgccttttccggg
acagattggatgttggagaaaatggatctgaaagagtttgacttcgatgctctgtttcga
atggatgacctggaaaccatgccagatgagcttttgaccacgttggatgacacatgtgat
ctttttgcccctctagtccaagagactaataaggagccccctcagacagtgaacccaatt
ggccatctcccagaaagtgtaataaaagtcgaccaggttgccccctttacattcttgcag
ccttttccctgttccccaggggttctgtcttccactccagatcattcctttagtttagag
ctaggcagtgaagttgatatctctgaaggagacaggaagcttgactccgctgcttatatt
actctaatccctcagtgtgtaaaggaggaagacactccctctgataatgacagtggcatc
tgtatgagccctgagtcctacctgggctctccccagcatagcccctccacctccagggcc
ccaccagacaatctgccttctccaggtggtccccgtggttctcctcgacccaaaccttat
gacccacctggagttagtttgacagctaaagtgaagactgagaagttggataagaagctg
aaaaagatggagcaaaacaagacagcagccactaggtaccgccagaagaagcgggctgag
caggaggccctcactggcgagtgtaaggagctagaaaaaaagaatgaggctctgaaagag
aaggcagattctctggccaaggagatccagtatctgaaagacctgatagaagaggtccgt
aaggcaagggggaagaagagagttccgtaa

KEGG   Mus caroli (Ryukyu mouse): 110312537
Entry
110312537         CDS       T05910                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110312537 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110312537 (Atf6b)
   04022 cGMP-PKG signaling pathway
    110312537 (Atf6b)
   04151 PI3K-Akt signaling pathway
    110312537 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110312537 (Atf6b)
   04915 Estrogen signaling pathway
    110312537 (Atf6b)
   04926 Relaxin signaling pathway
    110312537 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    110312537 (Atf6b)
   04918 Thyroid hormone synthesis
    110312537 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    110312537 (Atf6b)
   04925 Aldosterone synthesis and secretion
    110312537 (Atf6b)
   04927 Cortisol synthesis and secretion
    110312537 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312537 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312537 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    110312537 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312537 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    110312537 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    110312537 (Atf6b)
   05031 Amphetamine addiction
    110312537 (Atf6b)
   05034 Alcoholism
    110312537 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110312537 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312537 (Atf6b)
   05161 Hepatitis B
    110312537 (Atf6b)
   05163 Human cytomegalovirus infection
    110312537 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110312537 (Atf6b)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110312537 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB Docking
Other DBs
NCBI-GeneID: 110312537
NCBI-ProteinID: XP_021041869
Ensembl: MGP_CAROLIEiJ_G0021471
UniProt: A0A6P5RA03
LinkDB
Position
17
AA seq 706 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAQLYRCVEQDV
PFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQVP
GVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSASDDLPDIQTKLEPASPSSSVHS
EASLLSADSPSQPFIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKA
PATRKPPLQPKPVVLTTVPVPPRAGPTSAAVLLQPLVQQPAVSPVVLIQGAIRVQPEGPA
PAAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQAVLADNQQLRRENAALRRRLEALLAENSGLKLGSGNRKVVCIMVFLLFIAFNFGPVSI
SEPPPAPMSPRMSREEPRPQRHLLGFSEPGPAHGIEPLQEAARSPEEQQPSSAGRPSFRN
LTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPHRAQE
RQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPSRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPSPGNTTGGPLPGSAASPAHQASQPLYLNHP
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctcagcgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagtccggaggattgggacagcaccttgtacagt
ggcctggatgaagtggccgaggaacaggcacagttgtatcgttgcgtggagcaggatgtc
ccgtttgacagcagctctctggatgtggggatggatgtcagcccccctgagcccccttgg
gaccctctacccatcttcccagatcttcaggtgaagtctgagccatcctctccctgctcg
tcctcctccctcagctcagagtcctcacatctttccacagagccccccagccaggtccct
ggcgtaggggaggtgctgcatgtgaagatggagtccctggcacccccactctgcctgctg
ggggatgacccagcatccccctttgaaacagtccagatcactgtgggctctgcctctgat
gatcttccagatatccagaccaagctggaacctgcctctccgtcttcttctgtccactct
gaggcctccttgctgtcagccgactctcccagtcagccttttataggagaggaggttctg
gaagtgaagacagagtctccgtcccctccagggtgcctcctgtgggatgtcccagcctct
tcgctcggagctgtccagatcagcatgggtccatcccctgatagttcctcagggaaagct
ccagccactcggaagcctccactgcagcccaagcctgtggtactaaccacagttccggtg
ccacctagagctgggcctaccagcgctgctgtcctcctgcaacccctggtccagcagcct
gcggtgtccccagtggtcctcatccaaggtgctatccgagtccagcctgaagggccagct
cctgcagctccacggcctgagaggaagagcattgttccagcccctatgccggggaactcc
tgcccgcctgaagtggatgcaaagctgttgaagcggcagcagcggatgatcaagaatcga
gagtcagcctgccagtcccgccgcaagaagaaagagtacctgcaaggcctggaggcccgg
ctgcaggctgtgctggcagacaaccagcagctgcgcagggagaacgctgccctccggcgg
cggctggaggccctactggcagagaacagcgggctcaagctggggtctggaaacaggaag
gttgtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtgagcatc
agcgagccgcccccagctcccatgtctcctcggatgagcagggaggagcctcgaccccag
aggcacctgctgggcttctcagaaccagggccagctcatggcattgaaccccttcaggaa
gccgcccggagccctgaggagcagcagcccagctctgcaggcaggcctagcttcagaaac
ctgacggccttccccgggggggccaaggagctgctgctgagagacctggaccagctcttc
ctctcctcggactgccgccatttcaaccgaactgagtctctgaggcttgctgatgagctg
agtggctgggtccaacgtcaccagagaggtcgacggaagatacctcacagggcccaggag
agacagaagtctcagctacggaagaagtctcctccagtgaaacctgtccccacccaacct
ccaggaccccctgaaagggaccccgtgggccagctgcagctctaccgccaccccagccgc
tcacagccggagtttctagacgcaattgaccggagggaagataccttctatgttgtctcc
ttccgaagggaccacctgctgctcccagccatcagccacaacaagacatccaggcccaag
atgtcactggtgatgccagccatggcccccaatgagaccgtgtcaggccggggcccccca
ggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcac
atcaagacctctacggtgcccccctcgctccgaaagcagccgtccccgtccccgggcaat
accacaggtggccccttgccaggctctgcagctagtcctgctcatcaggcctcccagccc
ctctacctcaatcacccctga

DBGET integrated database retrieval system