KEGG   Mus caroli (Ryukyu mouse): 110285655
Entry
110285655         CDS       T05910                                 

Gene name
Fas
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04650  Natural killer cell mediated cytotoxicity
mcal04668  TNF signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal04940  Type I diabetes mellitus
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110285655 (Fas)
   04668 TNF signaling pathway
    110285655 (Fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110285655 (Fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110285655 (Fas)
   04217 Necroptosis
    110285655 (Fas)
   04115 p53 signaling pathway
    110285655 (Fas)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110285655 (Fas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285655 (Fas)
   05205 Proteoglycans in cancer
    110285655 (Fas)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110285655 (Fas)
   05330 Allograft rejection
    110285655 (Fas)
   05332 Graft-versus-host disease
    110285655 (Fas)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285655 (Fas)
   05022 Pathways of neurodegeneration - multiple diseases
    110285655 (Fas)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110285655 (Fas)
   04932 Non-alcoholic fatty liver disease
    110285655 (Fas)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110285655 (Fas)
   05161 Hepatitis B
    110285655 (Fas)
   05160 Hepatitis C
    110285655 (Fas)
   05164 Influenza A
    110285655 (Fas)
   05162 Measles
    110285655 (Fas)
   05168 Herpes simplex virus 1 infection
    110285655 (Fas)
   05163 Human cytomegalovirus infection
    110285655 (Fas)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110285655 (Fas)
   05169 Epstein-Barr virus infection
    110285655 (Fas)
   05165 Human papillomavirus infection
    110285655 (Fas)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110285655 (Fas)
   05143 African trypanosomiasis
    110285655 (Fas)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110285655 (Fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcal04050]
    110285655 (Fas)
   04090 CD molecules [BR:mcal04090]
    110285655 (Fas)
Cytokine receptors [BR:mcal04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110285655 (Fas)
CD molecules [BR:mcal04090]
 Proteins
  110285655 (Fas)
SSDB
Motif
Pfam: TNFR_c6 Death KdpC
Other DBs
NCBI-GeneID: 110285655
NCBI-ProteinID: XP_021007636
Ensembl: MGP_CAROLIEiJ_G0022889
UniProt: A0A6P5P1K6
LinkDB
Position
19
AA seq 327 aa
MLWIWAVLPLVLAGSQLSVHTEDTDSISEGLKLRRRVRETDKNCSEGLYQVGPFCCQPCQ
PGERKVKDCTMDGSTPTCAPCTEGRDYMDKKHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSSGCEHCVPCASCEHGTLEPCTATSNTKCRKQSSRNHLWLLTILVLLI
PLVFIYRKCRKRKCWKRRQDDPESRFSSHETIPMNASNLSLSKYIPRIAEDMTIQEAKRF
ARENNIKESKIDEIVHDSIQNTAEQKVQLLWCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGNSTSDIGNENERQCLE
NT seq 984 nt   +upstreamnt  +downstreamnt
atgctgtggatctgggctgtcctgcctctggtgcttgctggctcacagttaagtgtccat
actgaagatactgatagcatctccgagggtttgaagttgaggaggagggttcgtgaaact
gacaaaaactgctcggaaggattatatcaagtgggcccattttgctgccaaccatgccaa
cctggtgaacgaaaagttaaggactgcacaatggatgggagtacaccaacctgtgcccca
tgcacagaagggagggattacatggacaagaaacattatgctgataaatgcagaagatgc
acactctgtgatgaagagcatggtttagaagtggaaacaaactgcaccctgacccagaat
accaagtgcaagtgcaaaccagacttctactgcgattcttctggctgtgaacactgtgtt
ccctgcgcctcgtgtgaacatggaacccttgagccgtgcacagcaaccagcaatacaaaa
tgcaggaaacaaagttccagaaatcacctatggttgttgaccatccttgttttgttaata
ccacttgtatttatatatcgaaagtgccggaaaagaaagtgctggaaaaggagacaggat
gaccctgaatctagattctccagtcatgaaaccataccaatgaatgcctcaaatcttagc
ttgagtaaatacatcccaagaattgctgaagatatgacaatccaggaagctaaaagattt
gctcgagaaaataacatcaaggaaagcaagatagatgagatcgtgcatgacagcatccaa
aacacagctgagcagaaagtccagctgctctggtgctggtaccaatctcatggaaagagt
gatgcatatcaagatttaatcaaaggtctcaaaaaagctgaatgtcgcagaactttagat
aaatttcaggacatggtccagaaggaccttggaaactcaacctcagacatcggaaatgaa
aatgaaagacaatgtctggagtga

DBGET integrated database retrieval system