KEGG   Mus caroli (Ryukyu mouse): 110285703
Entry
110285703         CDS       T05910                                 

Gene name
Rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01523  Antifolate resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04137  Mitophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04380  Osteoclast differentiation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05030  Cocaine addiction
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05134  Legionellosis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05212  Pancreatic cancer
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05321  Inflammatory bowel disease
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110285703 (Rela)
   04014 Ras signaling pathway
    110285703 (Rela)
   04064 NF-kappa B signaling pathway
    110285703 (Rela)
   04668 TNF signaling pathway
    110285703 (Rela)
   04066 HIF-1 signaling pathway
    110285703 (Rela)
   04071 Sphingolipid signaling pathway
    110285703 (Rela)
   04024 cAMP signaling pathway
    110285703 (Rela)
   04151 PI3K-Akt signaling pathway
    110285703 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110285703 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    110285703 (Rela)
   04218 Cellular senescence
    110285703 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110285703 (Rela)
   04620 Toll-like receptor signaling pathway
    110285703 (Rela)
   04621 NOD-like receptor signaling pathway
    110285703 (Rela)
   04622 RIG-I-like receptor signaling pathway
    110285703 (Rela)
   04623 Cytosolic DNA-sensing pathway
    110285703 (Rela)
   04625 C-type lectin receptor signaling pathway
    110285703 (Rela)
   04660 T cell receptor signaling pathway
    110285703 (Rela)
   04658 Th1 and Th2 cell differentiation
    110285703 (Rela)
   04659 Th17 cell differentiation
    110285703 (Rela)
   04657 IL-17 signaling pathway
    110285703 (Rela)
   04662 B cell receptor signaling pathway
    110285703 (Rela)
   04062 Chemokine signaling pathway
    110285703 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110285703 (Rela)
   04917 Prolactin signaling pathway
    110285703 (Rela)
   04926 Relaxin signaling pathway
    110285703 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110285703 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110285703 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    110285703 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285703 (Rela)
   05202 Transcriptional misregulation in cancer
    110285703 (Rela)
   05203 Viral carcinogenesis
    110285703 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110285703 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110285703 (Rela)
   05221 Acute myeloid leukemia
    110285703 (Rela)
   05220 Chronic myeloid leukemia
    110285703 (Rela)
   05215 Prostate cancer
    110285703 (Rela)
   05222 Small cell lung cancer
    110285703 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110285703 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285703 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    110285703 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    110285703 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110285703 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110285703 (Rela)
   04931 Insulin resistance
    110285703 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110285703 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110285703 (Rela)
   05135 Yersinia infection
    110285703 (Rela)
   05133 Pertussis
    110285703 (Rela)
   05134 Legionellosis
    110285703 (Rela)
   05152 Tuberculosis
    110285703 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110285703 (Rela)
   05170 Human immunodeficiency virus 1 infection
    110285703 (Rela)
   05161 Hepatitis B
    110285703 (Rela)
   05160 Hepatitis C
    110285703 (Rela)
   05171 Coronavirus disease - COVID-19
    110285703 (Rela)
   05164 Influenza A
    110285703 (Rela)
   05162 Measles
    110285703 (Rela)
   05168 Herpes simplex virus 1 infection
    110285703 (Rela)
   05163 Human cytomegalovirus infection
    110285703 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110285703 (Rela)
   05169 Epstein-Barr virus infection
    110285703 (Rela)
   05165 Human papillomavirus infection
    110285703 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110285703 (Rela)
   05145 Toxoplasmosis
    110285703 (Rela)
   05140 Leishmaniasis
    110285703 (Rela)
   05142 Chagas disease
    110285703 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110285703 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110285703 (Rela)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110285703 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110285703
NCBI-ProteinID: XP_021007720
Ensembl: MGP_CAROLIEiJ_G0022562
UniProt: A0A6P5P231
LinkDB
Position
19
AA seq 549 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDSAGRPLLLTPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF
DEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPVPVLTPGPPQSLS
APVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQG
VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDF
SALLSQISS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatctttccctcagagccagcccaggcttctgggccttat
gtggagatcattgaacagcccaagcaacggggcatgcgattccgctataaatgcgagggg
cgctcagcgggcagtattcctggtgagagaagcacagataccaccaagacacaccccacc
atcaagatcaatggctacacaggaccaggaacagttcgaatctccctagtcaccaaggat
ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggatggctactat
gaggctgacctctgcccagaccgctgtatccatagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgaatccagaccaacaataacccc
tttcacgttcccatagaggagcagcgcggggactatgacttgaatgcagtgcgcctctgc
ttccaagtgacagtgcgggactcagcaggcaggcccctccttctgacccctgtcctctca
catccgatttttgataaccgggcccccaacactgccgagctcaagatctgccgagtaaac
cggaactccgggagctgcctcggtggggatgagatcttcttgctgtgtgacaaggtgcag
aaagaagacattgaggtgtatttcacgggaccaggctgggaggcacgaggctccttttct
caagctgatgtgcaccggcaagtggccattgtgttccggactcctccgtacgctgacccc
agcctacaggctcctgtgcgagtgtccatgcagctgcggcggccttctgatcgggagctc
agcgagcccatggagttccagtacttgccagacacagatgaccgccaccgaattgaagag
aagcgcaaaaggacatatgagaccttcaagagtatcatgaagaagagtcctttcaatgga
ccaactgaaccccggcctccaacccggcgtattgctgtgcctacccgaaactcaacttct
gtccccaagccagccccgcagccctacaccttcccagcatccctcagcaccatcaacttt
gatgagttttcccccatgctgttaccatccgggcagatctcaaaccaggccctggccttg
gcaccgtcctctgccccagtccttgcccagaccatggtcccttcctcagccatggtacct
ctggctcagcccccagctcctgtcccagttctaaccccgggtcctccccagtccctgtct
gcacctgttccaaagagcacccaggctggggaaggcacgctgtcggaagccctgctgcac
ctgcagtttgatgctgatgaagacttgggggccttgcttggcaacagcacagacccagga
gtgttcacagacctggcatctgtggacaattcagagtttcaacagctcctgaaccagggc
gtgtccatgtctcactccacagctgagcccatgctcatggagtaccctgaagctataacg
cgcctggtgacagggtcccagaggccccctgacccagctcccacacccctggggacctcg
gggcttcccaatggtctctccggagatgaagacttctcctccattgcggacatggacttc
tctgctcttttgagtcagatcagctcctaa

KEGG   Mus caroli (Ryukyu mouse): 110291231
Entry
110291231         CDS       T05910                                 

Gene name
Nfkb1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01523  Antifolate resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04380  Osteoclast differentiation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05030  Cocaine addiction
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05134  Legionellosis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05321  Inflammatory bowel disease
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110291231 (Nfkb1)
   04014 Ras signaling pathway
    110291231 (Nfkb1)
   04064 NF-kappa B signaling pathway
    110291231 (Nfkb1)
   04668 TNF signaling pathway
    110291231 (Nfkb1)
   04066 HIF-1 signaling pathway
    110291231 (Nfkb1)
   04071 Sphingolipid signaling pathway
    110291231 (Nfkb1)
   04024 cAMP signaling pathway
    110291231 (Nfkb1)
   04151 PI3K-Akt signaling pathway
    110291231 (Nfkb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110291231 (Nfkb1)
   04218 Cellular senescence
    110291231 (Nfkb1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110291231 (Nfkb1)
   04620 Toll-like receptor signaling pathway
    110291231 (Nfkb1)
   04621 NOD-like receptor signaling pathway
    110291231 (Nfkb1)
   04622 RIG-I-like receptor signaling pathway
    110291231 (Nfkb1)
   04623 Cytosolic DNA-sensing pathway
    110291231 (Nfkb1)
   04625 C-type lectin receptor signaling pathway
    110291231 (Nfkb1)
   04660 T cell receptor signaling pathway
    110291231 (Nfkb1)
   04658 Th1 and Th2 cell differentiation
    110291231 (Nfkb1)
   04659 Th17 cell differentiation
    110291231 (Nfkb1)
   04657 IL-17 signaling pathway
    110291231 (Nfkb1)
   04662 B cell receptor signaling pathway
    110291231 (Nfkb1)
   04062 Chemokine signaling pathway
    110291231 (Nfkb1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110291231 (Nfkb1)
   04917 Prolactin signaling pathway
    110291231 (Nfkb1)
   04926 Relaxin signaling pathway
    110291231 (Nfkb1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110291231 (Nfkb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110291231 (Nfkb1)
  09149 Aging
   04211 Longevity regulating pathway
    110291231 (Nfkb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291231 (Nfkb1)
   05202 Transcriptional misregulation in cancer
    110291231 (Nfkb1)
   05206 MicroRNAs in cancer
    110291231 (Nfkb1)
   05203 Viral carcinogenesis
    110291231 (Nfkb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110291231 (Nfkb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110291231 (Nfkb1)
   05221 Acute myeloid leukemia
    110291231 (Nfkb1)
   05220 Chronic myeloid leukemia
    110291231 (Nfkb1)
   05215 Prostate cancer
    110291231 (Nfkb1)
   05222 Small cell lung cancer
    110291231 (Nfkb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110291231 (Nfkb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110291231 (Nfkb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110291231 (Nfkb1)
  09165 Substance dependence
   05030 Cocaine addiction
    110291231 (Nfkb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110291231 (Nfkb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110291231 (Nfkb1)
   04931 Insulin resistance
    110291231 (Nfkb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110291231 (Nfkb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110291231 (Nfkb1)
   05135 Yersinia infection
    110291231 (Nfkb1)
   05133 Pertussis
    110291231 (Nfkb1)
   05134 Legionellosis
    110291231 (Nfkb1)
   05152 Tuberculosis
    110291231 (Nfkb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110291231 (Nfkb1)
   05170 Human immunodeficiency virus 1 infection
    110291231 (Nfkb1)
   05161 Hepatitis B
    110291231 (Nfkb1)
   05160 Hepatitis C
    110291231 (Nfkb1)
   05171 Coronavirus disease - COVID-19
    110291231 (Nfkb1)
   05164 Influenza A
    110291231 (Nfkb1)
   05162 Measles
    110291231 (Nfkb1)
   05168 Herpes simplex virus 1 infection
    110291231 (Nfkb1)
   05163 Human cytomegalovirus infection
    110291231 (Nfkb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110291231 (Nfkb1)
   05169 Epstein-Barr virus infection
    110291231 (Nfkb1)
   05165 Human papillomavirus infection
    110291231 (Nfkb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110291231 (Nfkb1)
   05145 Toxoplasmosis
    110291231 (Nfkb1)
   05140 Leishmaniasis
    110291231 (Nfkb1)
   05142 Chagas disease
    110291231 (Nfkb1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110291231 (Nfkb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110291231 (Nfkb1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110291231 (Nfkb1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_5 Ank_3 Death
Other DBs
NCBI-GeneID: 110291231
NCBI-ProteinID: XP_021013906
Ensembl: MGP_CAROLIEiJ_G0025661
UniProt: A0A6P5PA10
LinkDB
Position
3
AA seq 971 aa
MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCE
GPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGI
CTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEG
GGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDS
KAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSP
TDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRK
RQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSHYGFPPYGGITFHPG
ATKSNAGITHGTINTKFKNGPKDCAKSDDEESLTLAEKETEGEGPSLPMACTETEAVALA
STMEDKEQDVGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGD
SVLHLAIIHLHAQLVRDLLEVTSGLVSDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRV
GADLSLLDRWGNSVLHLAAKEGHDRILSILLKNRKAALLIDHPNGEGLNAIHIAVMSNSL
PCLLLLVAAGAEVDAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLH
IAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQV
FDILNGKPYEPVFTPDDILPQGDMKQLTEDTRLQLCTLLEIPDPDKNWATLAQKLGLGIL
NNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVT
TAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHG
YGQEGPIEGKI
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggcagacgatgatccctacggaactgggcaaatgtttcatttgaacactgctttgact
cactcaatatttaatgcagaattatattcaccagaaataccactgtcaacggatggccca
taccttcaaatattagagcaaccaaaacagaggggatttcgattccgctatgtgtgtgaa
ggcccatcacacggagggcttccgggagcctctagtgagaagaacaagaaatcctaccca
caggtcaaaatttgcaactatgtggggcctgcaaaggttatcgttcagttggtcacaaat
ggaaaaaacatccacctgcacgcccacagcctggtgggcaagcactgtgaggacgggata
tgtaccgtaacagcaggacccaaggacatggtggttggctttgcaaacctgggaatactt
catgtgactaagaaaaaggtatttgaaacactggaagcacggatgacagaggcgtgtatt
aggggctataatcctggacttctggtgcattctgaccttgcctatctacaagcagaaggc
ggaggagaccggcaactcacagacagagagaaggaaatcatccgccaggcagctgtgcag
cagaccaaggagatggatctgagcgtggtgcgcctcatgttcacagccttcctccccgac
agcaccggcagcttcactcggagactggagcctgtggtgtcagacgccatctatgatagc
aaagccccgaatgcatccaacctgaaaatcgtgagaatggacagaacagcagggtgtgtg
acgggaggggaagagatttaccttctctgcgacaaggttcagaaagatgacatccagatt
cggttttatgaagaggaagaaaatggcggagtttgggaaggatttggggacttttccccc
acggatgttcatagacagtttgccatagtcttcaaaacgccaaagtataaggatgtcaac
attacaaagccagcttccgtgtttgttcagcttcggagaaaatcagacctggaaacgagt
gaaccgaaaccttttctctactaccctgaaatcaaagacaaagaggaagtgcagaggaaa
cgccagaagctcatgcccaacttctcggacagcttcggcggcggcagtggagcgggagcc
ggtggtggaggcatgttcggtagtggcggtggcggagggagtaccggaagccctggccca
gggtatggctactcgcactacggatttcctccctacggtgggattacattccatccggga
gccactaaatccaacgcagggatcacccatggcaccataaacaccaaatttaaaaatggc
cctaaagattgtgccaagagtgatgacgaggagagtctgactctcgctgagaaggaaact
gaaggtgaggggcccagcctgcccatggcctgcaccgagacggaagcagttgccctggca
tccaccatggaagacaaggagcaggatgtagggtttcaggataacctctttctcgagaag
gctctgcagctcgccaggcgacatgccaacgcccttttcgactacgcggtgacaggggat
gtgaagatgttgctggccgtgcagcgccatctcactgccgtgcaggatgagaatggggac
agtgtcttacacttagccatcatccacctccacgctcagctcgtgagggatctgctggaa
gtcacatctggtttggtctctgatgacatcatcaacatgagaaatgacctgtatcagaca
cctctgcacttggccgtgatcaccaagcaggaagatgtggtagaggatttgctgagggtt
ggggctgatctgagtcttctggaccgctggggcaactctgtcctgcacctagctgccaaa
gaaggacatgacagaatcctcagcatcctactcaagaacagaaaagcagcgctccttatc
gaccaccccaatggggaaggtctaaatgccatccacatagctgtgatgagcaatagcctg
ccatgtctgctgctgctggtggctgccggggcggaagtcgatgctcaggagcagaagtct
gggcgcacagcgctgcacctagccgtggagtacgacaacatctcattggctggctgcctg
cttctggagggtgatgcccacgtggacagtaccacctatgatgggactacacctctgcat
atagcggccggaagagggtccaccagactggcagctcttctcaaagcagcaggagcagac
cccctggtggagaactttgagcctctctatgacctggacgactcttgggagaaggctgga
gaagatgagggagtggtgccaggtaccacacccctggacatggctgccaactggcaggta
tttgacatactaaatgggaaaccgtatgagcccgtgttcacacctgatgatatactacca
caaggggacatgaagcaactgacagaagacacgaggctgcaactctgcacactgctggaa
attcctgatccagacaaaaactgggccactctggcacagaagttgggtctggggatattg
aacaacgccttccggctgagtcctgctccttctaaaactctcatggacaactatgaggtc
tctgggggtaccatcaaagagctgatggaggccctgcaacagatgggctacacagaggcc
attgaagtgatccaggcagccttccgcaccccggcaaccacagcctccagccccgtgacc
actgctcaggtccactgtctgcctctctcatcttcctccacgaggcagcacatagatgaa
ctccgggatagtgacagcgtctgtgacagtggtgtggagacatccttccgcaaactcagc
tttacagagtctcttactggagacagcccactgctatctctgaacaaaatgccccacggt
tatgggcaggaaggacctattgaaggcaaaatttag

DBGET integrated database retrieval system