KEGG   Mus caroli (Ryukyu mouse): 110285868
Entry
110285868         CDS       T05910                                 

Definition
(RefSeq) glutathione S-transferase P 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00480  Glutathione metabolism
mcal00980  Metabolism of xenobiotics by cytochrome P450
mcal00982  Drug metabolism - cytochrome P450
mcal00983  Drug metabolism - other enzymes
mcal01100  Metabolic pathways
mcal01524  Platinum drug resistance
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05215  Prostate cancer
mcal05225  Hepatocellular carcinoma
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110285868
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110285868
   00982 Drug metabolism - cytochrome P450
    110285868
   00983 Drug metabolism - other enzymes
    110285868
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285868
   05204 Chemical carcinogenesis
    110285868
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285868
   05215 Prostate cancer
    110285868
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110285868
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110285868
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110285868
Enzymes [BR:mcal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110285868
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110285868
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 110285868
NCBI-ProteinID: XP_021007987
UniProt: A0A6P5P2R9
LinkDB
Position
19
AA seq 210 aa
MPPYTIVYFPSRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQKEAAQVDMVNDGVEDLRCKYVTLIYTNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDSFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccatacaccattgtctacttcccaagtcgagggcggtgtgaggccatgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagcttcccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaagaaccagaaggaggccgcccaggtggatatggtgaatgatggggtggaggacctt
cgctgcaaatatgtcaccctcatctacaccaactatgaaaatggtaagaatgactatgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacagcttccccctgctctctgcctat
gtggctcgcctcagtgccaggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgccccatcaatggcaatggcaaacagtag

KEGG   Mus caroli (Ryukyu mouse): 110285955
Entry
110285955         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase P 2-like
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00480  Glutathione metabolism
mcal00980  Metabolism of xenobiotics by cytochrome P450
mcal00982  Drug metabolism - cytochrome P450
mcal00983  Drug metabolism - other enzymes
mcal01100  Metabolic pathways
mcal01524  Platinum drug resistance
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05215  Prostate cancer
mcal05225  Hepatocellular carcinoma
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110285955
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110285955
   00982 Drug metabolism - cytochrome P450
    110285955
   00983 Drug metabolism - other enzymes
    110285955
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285955
   05204 Chemical carcinogenesis
    110285955
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285955
   05215 Prostate cancer
    110285955
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110285955
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110285955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110285955
Enzymes [BR:mcal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110285955
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110285955
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 110285955
NCBI-ProteinID: XP_021008087
LinkDB
Position
19
AA seq 286 aa
MDLKNRKVSLPCSPPPRLPGSWYTGHQDLVCFWGSVGCLRRWSLPVNIRRWVTSSLPAEL
APHCIGPTVRRNLEARVGAELYPHLTPATTGSLALQPRQGRCEVMRMLLADQGQSWKEEV
VTLDVWEQGTFKASCLFGQIPKFQDGDLTLYQSNAILRHLGRSFRLYGKDQQEAALVDMV
NDGLEDLFRRIAQQYHHILKELPGHLKPFETLLAQNRGGQSFIVGDQISFSDYRLLDVLL
NLELLFPGYLNDFPLFSAYXKSRPKLKAFLESPEHVNRPLAACIKM
NT seq 861 nt   +upstreamnt  +downstreamnt
atggatttaaaaaatagaaaggtgagtctgccctgctctccccctccacgtctgccagga
agctggtacactggacaccaggacttggtctgtttctggggcagtgtgggatgtctgagg
aggtggagtcttcctgtcaatataaggcgctgggtcacttcctctcttcctgctgagctt
gctccacactgcatcggcccaacagtaaggagaaacctggaggcgagggtgggggcagag
ttatacccccacctcacccctgctactaccggctccttggccctgcagcccaggcaaggg
cgctgtgaggttatgcgcatgctcctagccgaccagggccagagctggaaggaggaggtg
gtgaccttggatgtttgggagcaaggcacattcaaggcttcctgtctgtttggacagatc
cccaagttccaggatggagatctcaccctgtaccaatccaatgctatcctacggcacctg
ggccgctccttccggctctatggcaaagaccagcaagaggcagcactggtggacatggtg
aacgatggactggaagacctattcagacgcattgcccagcagtatcaccatatccttaag
gagcttccgggacacctgaagccatttgaaactctcctggcccagaacaggggtggccag
tccttcattgttggtgaccagatctctttctcggactaccgcctgctggatgtgcttctg
aacctcgagctcctgtttcctggttacttgaatgactttcccctgttctccgcctatnng
aaatcccgacccaagctcaaggccttcctggagtctccagagcacgtgaaccggcccctt
gctgcttgcataaagatgtga

DBGET integrated database retrieval system