KEGG   Mus caroli (Ryukyu mouse): 110286073
Entry
110286073         CDS       T05910                                 

Gene name
Lrp5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05200  Pathways in cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110286073 (Lrp5)
   04150 mTOR signaling pathway
    110286073 (Lrp5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110286073 (Lrp5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286073 (Lrp5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110286073 (Lrp5)
   05226 Gastric cancer
    110286073 (Lrp5)
   05224 Breast cancer
    110286073 (Lrp5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110286073 (Lrp5)
   05022 Pathways of neurodegeneration - multiple diseases
    110286073 (Lrp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110286073 (Lrp5)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110286073 (Lrp5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 110286073
NCBI-ProteinID: XP_021008193
Ensembl: MGP_CAROLIEiJ_G0022469
UniProt: A0A6P5P0W9
LinkDB
Position
19
AA seq 1611 aa
METAPTRAPPPPLLLLVLCCSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIVASGLED
AAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPMDIQVLSQERQPPFHTPCEEDNG
GCSHLCLLSPRDPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKI
ECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRQTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNP
CADGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLETNN
NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADD
LPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLN
DCVHSNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQ
LSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPSMLTSPSQSLSPDR
QPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFT
NMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGA
NRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAV
EEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQF
ACTTGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQ
DRSDEANCDAVCLPNQFRCTNGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHS
SAIGPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQ
HGPFPGIPCSKSVMRSMSLGGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNVDMFYSSGIPATARPYRPYVIRGMAPPTTPCSTDVCDSDYSTSRWKTSKYYL
DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
NT seq 4836 nt   +upstreamnt  +downstreamnt
atggaaacggcgccgacccgggcccctccgccgccgctgctgctgctggtgttgtgctgc
agcctggtccccgccgcggcctcaccgctcctgttgtttgccaaccgccgggatgtgcgg
ctagtggatgccggcggagtgaagctggagtccaccattgtggccagtggcctggaggat
gcagctgctgtagacttccagttctccaagggtgctgtgtactggacagatgtgagcgag
gaggccatcaaacagacctacctgaaccagactggagctgctgcacagaacattgtcatc
tcaggccttgtgtcacctgatggcctggcctgtgactgggttggcaagaagctgtactgg
acggactccgagaccaaccgcattgaggtggccaacctcaatgggacgtcccgtaaggtt
ctcttctggcaggacctggaccagccaagggccattgccctggatcctgcacatgggtac
atgtactggactgactggggggaagcaccccggatcgagcgggcagggatggatggcagt
acccggaagatcattgtagactccgacatttactggcccaatgggctgaccatcgacctg
gaggaacagaagctgtactgggccgatgccaagctcagcttcatccaccgtgccaacctg
gacggctccttccggcagaaggtggtggagggcagcctcactcacccctttgccctgacg
ctctctggggacacactctactggacagactggcagacccgctccatccacgcctgcaac
aaatggacaggggagcagaggaaggagatccttagtgctctgtactcacccatggacatc
caggtgctgagccaggagcggcagcctcccttccacacgccatgcgaggaggacaacggc
ggctgctcccacttgtgcctgctgtccccgagggatcctttctactcctgtgcctgcccc
actggcgtgcagttgcaggacaatggcaagacgtgtaaggcaggggctgaggaagtgctg
ctgctggctcggaggacagacctgaggaggatctctctggacacccctgacttcacagac
atagtgctgcaggtgggcgacatccggcacgccattgccatcgactacgatcccctggag
ggctacgtgtactggaccgacgatgaggtgcgggctatccgcagggcgtacctggatggc
tcaggtgcgcagacacttgtgaacactgagatcaatgaccccgatggcattgctgtggac
tgggtcgcccggaacctctactggacagatacaggcactgacagaatcgaggtgactcgc
ctcaacggcacctcccgaaagatcctggtatctgaggacctggacgaacctcgggccatt
gtgttgcaccctgtgatgggcctcatgtactggacagactggggggagaaccccaaaatt
gaatgcgccaacctagatgggagagatcggcatgtcctggtgaacacctcccttgggtgg
cccaacggactggccctggacctgcaggagggcaagctgtactggggggatgccaaaact
gataaaatcgaggtgatcaacatagatgggacaaagcggcagaccctgctcgaggacaag
ctcccacacatttttgggttcacactgctgggggacttcatctactggaccgactggcag
agacgcagtattgaaagggtacacaaggtcaaggccagccgggatgtcatcatcgatcaa
ctccccgacctgatgggactcaaagcggtgaatgtggccaaggttgtcggaaccaaccca
tgtgcggatggaaatggagggtgcagccatctgtgcttcttcaccccacgtgccaccaag
tgtggctgccccattggcctggagctgttgagtgacatgaagacctgcataatcccggag
gccttcctggtattcaccagcagagccaccatccacaggatctccctggagactaacaac
aacgatgtggctatcccactcacgggtgtcaaggaggcctctgcactggactttgatgtg
tccaacaatcacatctactggactgatgtcagcctcaagacgatcagccgagccttcatg
aatgggagctcggtggagcacgtgattgagtttggccttgactaccctgaaggaatggct
gtggactggatgggcaagaacctctattgggcggacacagggaccaacaggattgaggtg
gcccggctggatggacagttccggcaggtgcttgtgtggagagaccttgacaaccccagg
tctctggctctggatcctactaaaggctacatctactggactgagtggggcggcaagcca
aggattgtgcgggccttcatggatgggaccaattgtatgacactggtagacaaggtgggc
cgggccaacgacctcaccattgattatgccgaccagcgactgtactggactgacctggac
accaacatgattgagtcttccaacatgctgggtcaggagcgcatggtgatagctgacgat
ctgccctacccgtttggcctgactcaatatagcgattacatctactggactgattggaac
ctgcatagcattgaacgggcggacaagaccagcgggcgaaaccgcaccctcatccagggt
cacctggacttcgtcatggacatcctggtgttccactcctcccgtcaggatggcctcaac
gactgtgtgcacagcaatggccagtgtgggcagctgtgcctcgccatccccggaggccac
cgctgtggctgtgcttcacactacacgctggaccccagcagccgcaactgcagcccgccc
tccaccttcttgctgttcagccagaaatttgccatcagccggatgatccccgatgaccag
ctcagcccggaccttgtcctaccccttcatgggctgaggaacgtcaaagccatcaactat
gacccgctggacaagttcatctactgggtggacgggcgccagaacatcaagagggccaag
gacgacggtacccagccctccatgctgacctctcccagccaaagcctgagcccagacaga
cagccacacgacctcagcattgacatctacagccggacactgttctggacctgtgaggcc
accaacaccatcaatgtccaccggctggatggggatgccatgggagtggtgcttcgaggg
gaccgtgacaagccaagggccattgctgtcaatgctgagcgagggtacatgtactttacc
aacatgcaggaccatgctgccaagattgagcgagcctccctggatggcacagagcgggag
gtcctcttcaccacaggcctcatccgtcccgtggcccttgtggtggacaatgctctgggc
aagctcttctgggtggatgcagacctaaagcgcatcgaaagctgtgacctctccggggcc
aaccgcctgaccctggaagatgccaacatcgtacagccagtaggtctgacagtgctgggc
aggcacctctattggatcgaccgccagcagcagatgatcgagcgcgtggagaagaccact
ggggacaagcggactagggttcagggccgtgtcacccacctgacaggcatccatgccgtg
gaggaagtcagcctggaggagttctcagcccatccgtgtgcccgagacaatggtggctgc
tcccacatctgcatcgccaagggtgatggaacgccacgctgctcgtgccctgtccacctg
gtgctcctgcagaacctgctgacttgtggtgagcctcctacctgctcccctgatcagttt
gcatgtaccactggtgagatcgactgcatccccggagcctggcgctgtgacggcttccct
gagtgtgctgaccagagtgatgaagaaggctgcccagtgtgctccgcctctcagttcccc
tgtgctcgaggccagtgcgtggatctgcggttacgctgcgacggtgaggccgactgccag
gatcgctctgatgaagctaactgtgatgctgtctgtctgcccaatcagttccggtgcacc
aacggccagtgcgtcctcatcaagcaacagtgtgactccttccccgactgtgctgatggg
tctgatgagctcatgtgtgaaatcaacaagccaccctctgatgacatcccagcccacagc
agtgccattgggcccgtcattggtatcatcctctccctcttcgtcatgggcggggtctac
tttgtctgccagcgtgtgatgtgccagcgctacacaggggccagtgggccctttccccac
gagtatgtcggtggagcccctcatgtgcctctcaacttcatagccccaggtggctcacag
cacggtcccttcccaggcatcccgtgcagcaagtccgtgatgcgctccatgagcctgggg
ggggggcgtggcagcgtacccctatatgaccggaatcacgtcactggggcctcatccagc
agctcgtccagcacaaaggccacactatatccgccgatcctgaacccacccccgtcccca
gccacagacccctctctgtacaacgtggacatgttttattcttcaggcatcccggccacc
gctagaccatacaggccctacgtcattcgaggtatggcacccccaacaacaccttgcagc
acagatgtgtgtgacagtgactacagcaccagtcgctggaagaccagcaaatactacctg
gacttgaattcggactcagacccctacccacccccgcccactccccacagccagtatcta
tctgcagaggacagctgcccaccctcaccagtcactgagagaagctactgccacctcttc
ccacccccaccgtccccctgcacggactcttcctga

KEGG   Mus caroli (Ryukyu mouse): 110297114
Entry
110297114         CDS       T05910                                 

Gene name
Lrp6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05200  Pathways in cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110297114 (Lrp6)
   04150 mTOR signaling pathway
    110297114 (Lrp6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110297114 (Lrp6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297114 (Lrp6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110297114 (Lrp6)
   05226 Gastric cancer
    110297114 (Lrp6)
   05224 Breast cancer
    110297114 (Lrp6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110297114 (Lrp6)
   05022 Pathways of neurodegeneration - multiple diseases
    110297114 (Lrp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110297114 (Lrp6)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110297114 (Lrp6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Other DBs
NCBI-GeneID: 110297114
NCBI-ProteinID: XP_021021557
Ensembl: MGP_CAROLIEiJ_G0028978
UniProt: A0A6P5PX42
LinkDB
Position
6
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRVIGSNPCAEDNGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQGFNVVASSVANQNLEIQPYDLS
IDIYSRYIYWTCEATNVIDVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGD
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHSPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtgctgaggagcctcctggcctgcagcttctgcgtgctgctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgagattggttgatgctacaaatggcaaa
gagaatgcaacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtacagaatgttgttgtttctggattattgtccccggatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcgtattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccatcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctgggatggatggttcaagtcgcttcgttataataaacactgag
atttactggccaaacggactgactctggattatcaggagcggaagctttactgggccgat
gcaaaacttaatttcatccataaatcaaacctggatggaacaaatcggcaggcagtggtt
aaagggtcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gactggaatacacactctattttggcttgcaacaaatatactggcgagggtctgcgtgaa
attcattctaacatcttctctcccatggatatacatgctttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccaactggggtcaagctgctagagaatgga
aagacctgcaaagatggtgccactgaactattgctgttagcccgacggacagacttgagg
cggatttctttggatacacccgattttactgacattgttctgcagttagaagatatccgg
catgccattgccatagactacgaccctgtagaaggctacatatactggacggatgacgaa
gtgagggctattcgtcgctccttcatagatggatctggcagtcagtttgtggtcacggcc
cagattgctcatcctgatggtattgctgttgactgggttgcaaggaacctgtactggaca
gacactggcacggatcgtatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggagccccgggctatcgtgttagatcccatggttgggtacatg
tattggacagactggggagaaatcccaaaaatagagcgagctgctctggacggatctgac
cgagtagttcttgtcaacacttcccttggttggccaaatggcttagccctggattatgat
gaaggcacaatatactggggagatgccaaaacagacaaaattgaggttatgaataccgat
ggcaccgggaggcgagtgctggtggaagacaagatccctcacatatttgggtttaccttg
ctgggtgactatgtttactggactgactggcagaggcggagcatcgagagagtacacaaa
cggagcgcagagagggaggtcatcatagaccagctgccagacctcatgggactgaaggcc
acaagtgttcacagagtcattggttctaacccctgtgctgaggacaatggaggatgcagc
catctttgcctgtacaggcctcaggggcttcgatgcgcctgtcccattggctttgagctc
atcagtgacatgaagacatgcattgtccccgaggctttccttctgttctctcggagagcg
gatatcagacgcatatctttggaaacaaacaacaacaatgtggccattcctctcactggt
gtcaaagaagcctctgctttggattttgatgtcacagacaacaggatttactggactgat
atatcactgaagactattagcagagcctttatgaatggcagtgcactggaacatgtggta
gagtttggcttagattatccagaaggcatggcagtggactggcttgggaagaacttatac
tgggcagacacaggaacaaatcgtattgaggtatcaaagttggacggacagcaccgacag
gttttggtatggaaagaccttgacagtcctcgagctctggcactggatcctgcagaaggg
tttatgtattggactgagtggggaggcaagcctaagattgacagggctgctatggatgga
agtgaacgcactacattagttccaaatgtgggccgagccaatggtctcaccatcgactat
gctaaaaggcggctttactggacagacctggacactaacctaatagaatcctcaaatatg
ctcggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacagactggagccgacgcagcattgaacgtgccaacaaa
accagtggccaaaaccgcaccatcatccagggccatttggactatgtgatggacatcctg
gtcttccactcttcccggcaggcagggtggaatgaatgtgcctccagcaacgggcactgc
tcccacctctgcttggctgtgcccgtcggaggttttgtgtgtggatgccctgcccactac
tccctgaatgctgacaacaggacctgcagtgctcctaccaccttcctgctcttcagtcag
aagagcgccatcaaccgcatggtgattgatgaacaacagagccctgacatcatccttcct
atccacagccttcggaacgtccgggccattgattatgaccctttggacaagcagctctac
tggattgactctcgacaaaactccatacgaaaggcacatgaagatggtggccagggtttt
aatgtagttgcaagctcagtcgcaaatcagaatcttgaaatacagccctatgatctcagc
attgatatttatagccgttacatctactggacctgtgaagctaccaatgtcattgatgtg
acgagattagatggacggtcagttggagtggttctaaaaggcgagcaagacagacctcga
gccattgtggtaaaccccgagaaagggtatatgtattttaccaatcttcaggaaagatct
cctaaaattgaacgggctgcattggatggtacagaacgagaggtcctctttttcagtggc
ttaagtaaaccaattgctttggctcttgatagcaagctgggcaagctcttctgggctgac
tcagatctccggcgaattgaaagcagtgatctctcaggtgccaacaggatagtgctagaa
gactctaatatattacaacctgtgggcctgaccgtgtttgaaaactggctctattggatt
gataaacagcagcagatgattgaaaaaattgacatgactggtcgagaaggaagaaccaag
gtccaggctcgaattgctcagctgagtgacatccatgcagtaaaggagctgaaccttcag
gagtacagacagcacccttgtgcccaggataatggtggctgttcacatatttgccttgta
aaaggagatggtacgacaagatgctcctgccccatgcacttagttctgcttcaggatgag
ctgtcctgtggagagcctccaacgtgttctcctcagcagtttacctgcttcactggggac
attgactgcatccctgtggcttggcggtgtgatgggttcactgaatgcgaagaccacagt
gatgaactcaattgtcctgtgtgctcagagtctcagttccagtgtgccagtgggcagtgc
attgatggtgcccttcgatgcaatggtgatgcgaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcgttgga
aaacacaagaaatgtgaccacagtgtggactgcagtgacagatctgacgagctggactgt
tatccaactgaggagccagcaccacaagccaccaacacagttggttccgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagaggatgctgtgtcct
cgtatgaagggagacggggagaccatgactaacgactatgtggttcacagcccggcttct
gtgccccttggttatgttcctcacccaagctctctctctggatctcttccaggaatgtct
cgaggcaaatcaatgatcagttccctcagtatcatggggggaagcagtgggcccccctat
gatcgagcgcacgtcacgggagcatcctcaagcagttcttccagtaccaaaggcacttat
ttccctgcaattttgaacccaccaccatcgcctgccacagaaagatcccattacaccatg
gaatttggttattcttccaacagtccttccacacataggtcctacagctataggccgtac
agctaccggcactttgcaccgcccaccacaccctgcagcactgatgtctgtgacagtgac
tatgctcctagccggaggatgacctcagtggcaacagccaagggctacaccagtgacttg
aactatgactcagaacctgtgcccccaccgcccacaccccgaagccagtacttgtcagcg
gaggagaactatgaaagctgtcccccttccccatacacggagaggagttactcccaccac
ctctacccgccaccaccctccccctgcacggactcctcctga

DBGET integrated database retrieval system