KEGG   Mus caroli (Ryukyu mouse): 110286147
Entry
110286147         CDS       T05910                                 

Gene name
Ralgds
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110286147 (Ralgds)
   04015 Rap1 signaling pathway
    110286147 (Ralgds)
   04072 Phospholipase D signaling pathway
    110286147 (Ralgds)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286147 (Ralgds)
   05231 Choline metabolism in cancer
    110286147 (Ralgds)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110286147 (Ralgds)
   05212 Pancreatic cancer
    110286147 (Ralgds)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 110286147
NCBI-ProteinID: XP_021008285
Ensembl: MGP_CAROLIEiJ_G0023352
UniProt: A0A6P5P137
LinkDB
Position
2
AA seq 853 aa
MMVDCQSSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRT
VKAGTLEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKSRYGRCDALTASS
RYGCILPYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPG
SDLERRAHLLLAQLEDLEPSEAEPEALSPAPVLSLKPASQLEPALLLTPSQAVTSTPVRE
PATAPVPVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESTPMPTPA
LEPSWSLPEVTENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKK
GKEHLAPTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSS
LYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFA
TLEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEV
IAQIKLLQSACNNYSIAPEEHFGAWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKS
TAIVKRWSDRQAPSTELSTSSSAHSKSCDQLRCSPYLSSGDITDALSVHSAGSSSSDVEE
INMSFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSG
VCSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDED
EPEDYELVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPR
MKQKGLRIAKGIF
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgatggtagattgccagagctccacgcaggagattggggaggaactgatcaacggggtc
atctactccatctccctgcgcaaggtccagctacaccaaggagccactaagggccagcgc
tggctagggtgtgagaacgagtcggctctgaacctctatgagacctgcaaggtgcgcacg
gtgaaggctggcactctggagaagctggtggagcacctggtgcctgccttccagggcagt
gacctttcctacgtcaccgtcttcctgtgcacctacagagccttcactaccacccagcag
gtgctagacctgctgttcaaaagcaggtacggtagatgtgacgccctcacggcctcctct
agatatggctgcatcctcccctactccagtgaggacggtggaccgcaggaccaactcaaa
aatgccatctcctccatcctgggcacctggctggaccaatactcagaggatttctgtcaa
cctccggactttccctgcctcaagcagctggtggcttatgtacagctcaacatgcctggc
tcagatctggagcgccgcgctcaccttctcctggcccagctggaggacctggagcccagt
gaggctgagcctgaggccctgtccccagctccagtgctgtctctgaagccagcttcacag
ctagaaccagcactgctgctgacgcccagccaagcggtgacatcaactccagtacgagag
cccgccacggccccagtgccagtgctggcctccagcccagtggtggcaccagctcctgag
ctagaaccagttccagagccacctcaagagcctgagccatccctagcactggctccagag
ctggagcccgccgtctcacagagcctggaactggagtcaactcctatgcccactcctgcc
ttagagccttcctggtctctgcctgaagtcacagagaatggactaaccgagaagcctcac
cttctgctgttccctcctgacttggtggctgaacagtttactctgatggatgcagaacta
ttcaagaaagtcgtgccctaccactgcctgggctccatctggtcccaaagggacaagaag
ggcaaggagcacctcgcgcctaccatccgcgccactgtcgcccagttcaacaacgtggcc
aactgtgtcattactacctgccttggggaccagagtatgaaggctccggacagggcccgg
gtggtggaacactggatcgaggtggccagggagtgcagagcgctcaagaatttctcctcc
ctctacgccatcctctctgctctacagagcaatgccatccaccgcctaaagaagacgtgg
gaggaggtctccagggacagctttcgagtgttccagaaactgtcggagatcttctctgat
gagaacaactactccctgagcagagagctgctcatcaaggaaggaacctccaagtttgcc
acactggagatgaaccctaggagagcccagagacgtcagaaggagacaggagtcatccag
ggcaccgttccctacctgggcacattcctcactgacctggtgatgctggacactgccatg
aaggactatctctatgggagactgatcaactttgaaaagagaaggaaggagttcgaagtc
attgcccagatcaagttgctgcagtcagcctgcaacaactacagcattgctccggaagaa
cactttggagcctggttccgagctatggagcgactcagtgaggctgagagctacaccctg
tcgtgtgagctggagcccccatctgagtcagccagcaacaccctgaggagcaagaaaagc
acagccattgtcaagcgctggagcgaccgccaggctcccagcacagagctcagcaccagt
agcagtgcccactccaagtcctgtgaccagcttcggtgcagcccttacctcagcagcggg
gacatcactgacgcgctcagtgtgcactcagctggctcttccagctctgatgtggaggag
atcaacatgagctttgtcccagagtctcctgatggccaggaaaagaagttctgggagtca
gcctcccagtcgtccccagagacctctggcatcagctccgcctccagcagcacctcctct
tcgtcagcctccaccacgcccgtgtctaccacgcgtacccacaagcgctccgtctcaggg
gtctgcagctacagctcctcactgcctctctacaaccagcaggtgggcgactgctgcatc
atcagggtcagcctggatgtggacaacggcaacatgtacaagagcatcctggtgaccagc
caggataaggctccgactgtcatccgaaaagccatggacaaacacaacctagatgaggac
gagccggaggattatgagctggtgcagatcatctcagaggatcacaagctgaagattcca
gaaaacgccaatgtgttctatgccatgaactctaccgccaactatgacttcattctaaag
aagcggaccttcactaagggggctaaagtcaagcatggagccagctccaccctccctcgt
atgaagcagaagggactcaggattgccaaaggcatcttctaa

DBGET integrated database retrieval system