KEGG   Mus caroli (Ryukyu mouse): 110286479
Entry
110286479         CDS       T05910                                 

Gene name
Pak3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05132  Salmonella infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110286479 (Pak3)
   04014 Ras signaling pathway
    110286479 (Pak3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110286479 (Pak3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110286479 (Pak3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110286479 (Pak3)
  09158 Development and regeneration
   04360 Axon guidance
    110286479 (Pak3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110286479 (Pak3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110286479 (Pak3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110286479 (Pak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110286479 (Pak3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110286479 (Pak3)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110286479 (Pak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N APH DSHCT Kdo
Other DBs
NCBI-GeneID: 110286479
NCBI-ProteinID: XP_021008472
Ensembl: MGP_CAROLIEiJ_G0033470
LinkDB
Position
X
AA seq 580 aa
MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTNSPFQTSRPVTVASSQTEGKMPDLYGSQ
MCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGD
KSAHGYIAAHQSNTKTASEPPLAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTR
SVVESIASPAAPNKEATPPSAENANSTTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDP
KKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPN
IVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVI
HRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVD
IWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDV
DRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtctgacagcttggataacgaagaaaaacccccagctcccccactgaggatgaacagt
aacaaccgagactcttcagcactcaaccacagctccaaaccactgcccatggccccagaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagaacgcccagagatctctcttccttcagactttgagcatacgatt
catgtgggttttgatgcagtcaccggggaattcactaactcccctttccagacctctaga
cctgtgacggtcgcttcaagtcaaacagagggaaaaatgccagatctctatggctcacag
atgtgcccagggaagctcccagagggaattcctgagcaatgggcacgactactccaaacc
tccaacataacaaagctggaacagaagaagaacccacaagctgttcttgatgttctcaaa
ttctatgactccaaagaaacggtcaacaaccagaaatatatgagctttacatcaggagat
aaaagtgcccacggatacatagcagcacatcagtcgaataccaaaacagcttcggaacct
cctttggctcctcctgtatctgaagaagaggatgaagaagaggaagaggaagaagatgac
aatgagcccccgcctgtcattgcaccaagaccagagcatacaaaatcaatctatactcgc
tctgtggttgagtcaattgcttcaccagctgcaccaaataaagaagccaccccaccttct
gctgagaatgccaattccactactttgtacaggaatacagatcggcaaagaaaaaagtcc
aagatgacggatgaggagatcctagagaagctgagaagcattgtgagtgttggggaccca
aagaagaaatatacgagatttgaaaaaattggccaaggggcatcaggaactgtttacaca
gcactagacattgcgactggacaagaggtggccataaagcaaatgaaccttcaacagcaa
cccaaaaaggaattaattattaatgaaattcttgtcatgagggaaaataagaaccccaat
attgtcaattatttagatagctacttagtgggtgatgaactgtgggtagtcatggaatac
ttggctggtggctctttgactgatgtggtcacagaaacctgtatggatgaaggacagata
gcagctgtctgtagagagtgcctccaagctttggatttcttgcactcaaaccaagtgatc
cacagagacataaagagcgacaacattctcctcgggatggatggttctgttaaactgact
gattttgggttctgtgcccaaatcactcctgagcaaagtaaacgaagcactatggtgggc
actccctattggatggcacctgaggtggtaactcgaaaagcttatggtccaaaagttgat
atctggtctctgggaatcatggccattgaaatggtggaaggtgaacccccttaccttaat
gaaaatccactcagggccttatatctgatagccactaatgggaccccagagctccagaat
cccgagagactgtcagctgtattccgtgacttcttaaatcgctgtcttgagatggatgtg
gatagaagaggatctgctaaggagcttttgcagcatccgtttttaaaattagccaagccc
ctctctagtctcactcctctgattatcgccgcaaaggaagcaattaagaacagtagccgt
tag

KEGG   Mus caroli (Ryukyu mouse): 110288173
Entry
110288173         CDS       T05910                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05170  Human immunodeficiency virus 1 infection
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110288173
   04014 Ras signaling pathway
    110288173
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110288173
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110288173
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110288173
  09158 Development and regeneration
   04360 Axon guidance
    110288173
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110288173
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110288173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110288173
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110288173
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110288173
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 110288173
NCBI-ProteinID: XP_021010259
Ensembl: MGP_CAROLIEiJ_G0024119
UniProt: A0A6P7QY33
LinkDB
Position
2
AA seq 682 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPTEGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDD
QWAADPDMYLQSPQSEHTDPHGLYLSCNGGTPAGHRQVPWPEPQSPQALPNGMAAKAQSL
GPAEFQGASQRCLQQLGACLQSSPPGTSPPMATGRRGVKVAKHSSEEARPQSCLVGSAIS
RPGGEGSPSPKNQESSLKHRLFRSMFLSTPATGPASSSKPVPLPQNKPNSAFRPPQKDSS
SNLVAKAQSLPSEQPMGTFSPLTTSDTSSPQKSLRIAPAAGPLPGRSSPAGSPRTRHAQI
STSNLYLPQDPTVAKGALGGEDTGIVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTG
IVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWV
LMEFLQGGALTDIISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGR
VKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEP
PYFSDSPVQAMKRLRDSAPPKLKNSYKVSPVLRDFLDRMLVREPQERATAQELLDHPFLL
QTGLPECLVPLIQLYRKQTSTC
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgtcctgagatatcagccccgcagaacttccagcat
cgtgtccacacctcctttgaccccaaggaaggcaagtttgtgggtctgcccccacaatgg
cagaacattctggatacactgaggcggcccaagcctgtggtggatccttctcgaatcaca
cgggtgcagttgcagcccatgaagacagtggtacggggcagctcagtgcccacggagggc
tacatctcggggctgctcaacgacattcagaagttgtcagttatcagctccaacaccctg
cgtggacgcagccccaccagccggcggcgggcacagtccctggggctgctgggagatgat
cagtgggctgctgaccctgatatgtacctccaaagcccccagtcggagcacactgatccc
catggcctctacctcagctgcaatgggggcacaccagcaggtcacaggcaggtgccctgg
ccagaaccacagagcccgcaggccctgcccaatgggatggctgccaaggcgcagtccctg
ggccctgctgagttccagggtgcctcacaacgctgcctgcagcagctgggtgcctgtctg
cagagttccccacctggtacctcaccccctatggccacagggaggcgtggggtgaaggtt
gccaagcatagctccgaagaggcccggccacagtcctgcctagtgggctcggccattagc
aggccaggtggagaaggcagccctagccctaagaaccaggaaagcagcctcaagcaccgg
ctcttccgaagcatgttcctgtctactcctgccacaggcccggcaagcagcagcaaaccg
gtccctctgccacagaacaagcccaattctgctttccgaccaccacaaaaagactcctcc
tcaaacctggtagccaaggcccagtccttgccctcagagcagcccatggggaccttcagt
cctctgaccacctcagataccagcagcccccagaagtccctccgcatagccccagccgct
ggtccacttccaggccggtcttctccagcaggctccccccgtacccggcatgctcagatc
agcaccagcaatctctacctgccccaggaccccacagtggccaagggggccctgggtggc
gaagacacaggcattgtgacccatgaacagttcaaggctgcgctcaggatggtggtggac
cagggtgaccctcggctgctgctggacagctacgtgaagattggggagggctccacgggc
attgtgtgtctggcccgggagaagcactcaggtcgccaggtagcagtcaagatgatggac
ctcaggaagcagcaacgcagggagctgctctttaatgaggtggtgatcatgcgtgactac
cagcacctcaacgtggtggagatgtacaagagttacctggtaggagaggaactgtgggtg
ttgatggagttcctgcagggcggggccctcacagacatcatctcccaagtcagactgaat
gaggagcagattgccactgtgtgtgaagctgtgcttcaggccttggcttacctgcacgcc
cagggtgtcatccaccgagatatcaagagtgattccatcctgctgacccttgatggcagg
gtgaagctctcagactttgggttctgtgctcagatcagcaaagatgttcccaagagaaag
tccctggtaggaactccatactggatggctcctgaagtgatctccagatccctatacgcg
actgaggtggatatctggtctctgggcatcatggtgattgagatggtggatggagaaccc
ccctacttcagtgactccccagtgcaagccatgaagaggctgcgggacagcgccccaccc
aagctaaagaactcttacaaggtctctccagtgctgcgagacttcctggatcggatgctg
gtacgggaaccccaagagcgagccacggcccaggagctcctggatcacccgtttctgctg
cagacggggctgcctgagtgtctggtgcctctgatacagctctaccgcaagcagacctct
acctgctga

KEGG   Mus caroli (Ryukyu mouse): 110289454
Entry
110289454         CDS       T05910                                 

Gene name
Pak5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05170  Human immunodeficiency virus 1 infection
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110289454 (Pak5)
   04014 Ras signaling pathway
    110289454 (Pak5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110289454 (Pak5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110289454 (Pak5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110289454 (Pak5)
  09158 Development and regeneration
   04360 Axon guidance
    110289454 (Pak5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110289454 (Pak5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110289454 (Pak5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110289454 (Pak5)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110289454 (Pak5)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110289454 (Pak5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 110289454
NCBI-ProteinID: XP_021011320
Ensembl: MGP_CAROLIEiJ_G0024355
UniProt: A0A6P7QQI9
LinkDB
Position
2
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRMQGHS
EENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHATKMKHGDA
YYPEMKSLKTDLAGFPVDYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggccgaagcccatggtggacccatcatgcatcaca
cccatacagctggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaacc
tctatcaatggtctgctagaggattttgacaacatctccgtgactcgctccaactctcta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcatgcaaggccactcg
gaagagaacggcttcatcactttctcacaatattccagtgaatccgatactactgcggac
tacacaactgaaaagtacagagacaggagtctctatggagatgacctggatctatactat
aaaagcagccatgcagccaagcaaaatgggcatgccacgaagatgaaacatggagacgct
tactaccctgagatgaagtctttgaaaaccgacctggccggattccctgtcgactatcac
acccacttggactctctgagaaaatcaagtgaatacggtgaccttaggtgggattatcag
agagcctccagtagctcccctctggactactcattccagctcacgccttctagaactgca
gggaccagcaggtgctccaaggagagtttggcatacagtgaaagtgattggggaccaagc
ctggatgactatgacaggaggccaaaatcatcatacctgcatcagacaagccctcagcca
gccatgcgccagagatccaagtcaggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcaccctcaaggacactcgtacaactcctacacctaccctcga
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacttaccccagaggccccaccaaactacctcaaagt
caaagcaaagcaggctactcttcaggcagccaccagtacccttctgggtaccacaaagca
tctctataccaccatccatccctgcaaaccagttctcagtacatctccaccgcttcttac
ttaagctctctcagtatctcctcgagcacctaccctccacctagctggggctcctcctca
gaccagcagccctcaagggtatcccatgaacaattccgagctgccctgcaactggtggtc
agcccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgaca
ggcatcgtgtgcattgcaacggagaaacacacaggcaagcaagtggcagtgaagaaaatg
gacctccgaaagcagcagagacgggaactcctttttaatgaggtcgtgataatgcgtgat
taccaccatgacaacgtagttgacatgtacaacagctaccttgttggagatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtcactcataccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgaaagctctgtcctaccttcat
aaccaaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggc
cggataaagttatctgactttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aaatcactggtgggtaccccatactggatggcacctgaggtgatttccaggctaccttat
gggacagaggtggacatctggtccctcgggataatggtgatagagatgattgatggtgag
cccccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttccatgctccgaggattcctagatcttatg
ttggtgagggagccctctcaaagagccacagctcaagaacttcttggacatccattctta
aaattggcaggtccaccatcttgcattgttcctctcatgagacaatacagacatcactga

KEGG   Mus caroli (Ryukyu mouse): 110297818
Entry
110297818         CDS       T05910                                 

Gene name
Pak4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05170  Human immunodeficiency virus 1 infection
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110297818 (Pak4)
   04014 Ras signaling pathway
    110297818 (Pak4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297818 (Pak4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110297818 (Pak4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110297818 (Pak4)
  09158 Development and regeneration
   04360 Axon guidance
    110297818 (Pak4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110297818 (Pak4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110297818 (Pak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110297818 (Pak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297818 (Pak4)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110297818 (Pak4)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110297818 (Pak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND
Other DBs
NCBI-GeneID: 110297818
NCBI-ProteinID: XP_021022490
Ensembl: MGP_CAROLIEiJ_G0029447
UniProt: A0A6P7R5E7
LinkDB
Position
7
AA seq 593 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAAPARMVPDKAGGRARATGHSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPL
SGPDVSTPQPGSLTSGTKLAAGRPFNTYPRADTDHPPRGAQGEPHTMAPNGPSATGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcagccccatccaacttcgagcaccgg
gtacacacaggctttgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggaatcagcgcgcagacccaagcccctgatcgaccctgcctgcatcacg
tccatccagcctggagcccccaagaccatcgttcggggcagcaaaggtgccaaggatggg
gctctcactctgctgcttgacgaatttgagaacatgtcggtgacgcgctccaactctcta
cgaagagagagtccaccaccacctgcccgtgcccaccaggagaatggaatgctggaggag
cgggcagccccggccagaatggtccccgacaaagctggaggcagagcccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtgggaccagagaagaggccc
aaatcttcgagggatggtccaggaggaccccaggaggcctcccgcgataagcgcccactc
tctgggcctgatgtcagcactcctcagcctggcagtctgaccagcgggacaaaactagca
gctggcaggccctttaacacatacccacgggctgacacggaccacccaccccgcggtgcc
cagggggagccacataccatggcccctaatgggccatcagccacaggcctggccgctcct
cagtcttcctcctcctcccggcctcccacccgggcccgtggtgctcccagcccaggagtt
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtaccccctgcccctgggccccctgggcctcgttcaccacagcgggagccccaacga
gtgtcccatgagcagttccgggctgccctgcagctggtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggtgagggctctacaggtattgtgtgcattgcc
actgtgcgcagctcaggcaaactggtggccgtcaagaagatggacttgcgcaagcagcaa
agacgtgaactgcttttcaatgaggtggtgatcatgcgggactaccggcacgagaacgtg
gtggagatgtacaacagctacctggtgggtgatgagctctgggtcgtcatggagttcctg
gaaggcggcgccctcaccgatattgtcacccacaccaggatgaacgaggaacagatcgcc
gccgtgtgcctggctgtgcttcaggcgctggccgtgctccacgcccagggtgtcatccac
cgtgacatcaagagtgactccatcttgctgacccacgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccgtattggatggccccggagctcatctcccgccttccctatgggccagaggtggatatc
tggtcactgggggtgatggtgatcgagatggtggatggggaacccccttacttcaacgag
ccacccctcaaagctatgaagatgatccgggacaacctcccaccccgactgaagaacctg
cacaaggcgtcaccgtctctgaaaggcttcttggatcgcctgctggtgcgtgacccggcc
cagcgggccactgctgctgagctgctgaagcatccgttcctcaccaaggcggggccacca
gccagcatcgtgcccctgatgcgccagcaccgaaccagatga

KEGG   Mus caroli (Ryukyu mouse): 110298300
Entry
110298300         CDS       T05910                                 

Gene name
Pak1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04360  Axon guidance
mcal04392  Hippo signaling pathway - multiple species
mcal04510  Focal adhesion
mcal04625  C-type lectin receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04810  Regulation of actin cytoskeleton
mcal05132  Salmonella infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110298300 (Pak1)
   04012 ErbB signaling pathway
    110298300 (Pak1)
   04014 Ras signaling pathway
    110298300 (Pak1)
   04392 Hippo signaling pathway - multiple species
    110298300 (Pak1)
   04024 cAMP signaling pathway
    110298300 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110298300 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110298300 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110298300 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    110298300 (Pak1)
   04660 T cell receptor signaling pathway
    110298300 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    110298300 (Pak1)
   04062 Chemokine signaling pathway
    110298300 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    110298300 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110298300 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110298300 (Pak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110298300 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110298300 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110298300 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110298300 (Pak1)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110298300 (Pak1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110298300 (Pak1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110298300 (Pak1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110298300 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    110298300 (Pak1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110298300 (Pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 110298300
NCBI-ProteinID: XP_021023121
Ensembl: MGP_CAROLIEiJ_G0030009
LinkDB
Position
7
AA seq 544 aa
MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcgtagacatccaggacaaacccccagcccctccgatgagaaacacc
agcactatgattggagctggcagcaaagacactggaaccctaaaccacggctccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttttatcgatccatcttacct
ggagataaaacaaataagaagaaggagaaggagcgaccagagatttctcttccttcagat
tttgagcatacaattcatgttggttttgatgctgtcacaggggagtttacgggaatgcca
gaacagtgggcccgcttgcttcaaacatcaaatatcacaaagtcagagcagaagaaaaac
ccacaggctgttctggatgtgctggaattttataactccaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagccgaagattataattcttctaacactttgaat
gtgaagactgtgtctgagaccccagcagtaccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatctgtatat
acacgatctgtgattgaaccacttcctgttactccaactcgggatgtggctacatctcct
atttctcctactgagaataacaccactccgccagatgctttgacccggaacactgaaaaa
cagaagaagaagcctaaaatgtctgatgaggagatcttagagaaattacggagcatagtg
agtgtgggtgatcctaagaagaagtacacacggttcgagaagattggacaaggtgcttca
ggcacagtgtatactgcaatggatgtagccacagggcaggaggtggccattaaacagatg
aatcttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaaaaacccaaatattgtcaactacctggacagttaccttgtgggagatgagctgtgg
gttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacctgtatg
gatgaaggtcagatagcagctgtgtgccgagagtgtctacaagctttggagtttctacat
tcaaaccaagtcattcacagggacatcaagagtgacaatattctgctgggaatggatggc
tctgtcaagttaactgactttggattctgtgcacagataactccagagcagagcaaaagg
agcactatggtgggaactccatattggatggcacctgaagttgtgacacgcaaggcctat
ggacccaaggttgacatctggtccctgggtattatggcaattgaaatgattgagggggag
cccccatacctcaatgaaaaccctttgagagccttgtacctcattgctaccaatgggacg
ccagagcttcagaacccagagaagttgtcagctattttccgggactttctgaaccgctgt
cttgagatggatgtggagaagagaggctcagctaaagagctactgcagcatcagttcctg
aagattgccaagcccctctctagcctgactccactgattgctgcagcaaaagaggcaacc
aagaacaatcactga

KEGG   Mus caroli (Ryukyu mouse): 110311434
Entry
110311434         CDS       T05910                                 

Gene name
Pak2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05170  Human immunodeficiency virus 1 infection
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110311434 (Pak2)
   04012 ErbB signaling pathway
    110311434 (Pak2)
   04014 Ras signaling pathway
    110311434 (Pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311434 (Pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110311434 (Pak2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110311434 (Pak2)
  09158 Development and regeneration
   04360 Axon guidance
    110311434 (Pak2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110311434 (Pak2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110311434 (Pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110311434 (Pak2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110311434 (Pak2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE20 family
   110311434 (Pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 110311434
NCBI-ProteinID: XP_021040404
Ensembl: MGP_CAROLIEiJ_G0020661
UniProt: A0A6P7QIJ2
LinkDB
Position
16
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagagctagaagacaagcccccagcacctccagtgcggatgagcagt
accatttttagcaccggaggaaaagatcctttatcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaaacccaggaacaaaatcatctccatattctctggcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctcccccatctgatttt
gagcacaccatccatgttggctttgatgctgttacgggagagttcactggcatgccagaa
cagtgggcacggctgttgcagacctccaacattaccaaactggagcagaagaagaaccct
caggcagtgctggatgtcttgaagttctacgactccaacactgtgaaacagaagtacctg
agtttcactcctcctgagaaagatggcttcccttctggaacaccagcactgaacacgaag
gggtcagagacatcagctgtagtgacagaggaagacgacgacgatgaagacgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatttacacacggtctgtcatcgac
cccattcctgctccagttggtgattctaatgttgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggggacccaaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
gggacagttttcactgcgactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtacctcgctggtgggtccctcactgatgtcgtaacagaaacctgcatg
gacgaagcgcagatcgcagctgtatgcagagagtgtttgcaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaacttactgacttcggcttctgtgcccagatcactcctgaacagagcaaacgc
agtactatggttggaacaccgtactggatggcaccagaggtggtgacacggaaagcctat
ggtcccaaagttgacatatggtctctgggcatcatggctatcgagatggttgaaggagag
cctccatacctcaacgaaaatcctctgcgggcattatacctgatagcaacaaatggaact
cctgaacttcagaatccagaaaaactttccccaatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaaaaggggttctgccaaggaactgttacagcatcctttcctg
aaactggccaaaccattgtctagcttgacgccactgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system