KEGG   Mus caroli (Ryukyu mouse): 110286603
Entry
110286603         CDS       T05910                                 

Gene name
Tfe3
Definition
(RefSeq) transcription factor E3 isoform X1
  KO
K09105  transcription factor E3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04137  Mitophagy - animal
mcal05202  Transcriptional misregulation in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110286603 (Tfe3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110286603 (Tfe3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110286603 (Tfe3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110286603 (Tfe3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    110286603 (Tfe3)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 110286603
NCBI-ProteinID: XP_021008727
Ensembl: MGP_CAROLIEiJ_G0032897
UniProt: A0A6P5P4F3
LinkDB
Position
X
AA seq 572 aa
MSHAAEPARDAVEASAEGPRAVFLLLEERRPAESAQLLSLNSLLPESGIVADIELENILD
PDSFYELKSQPLSLRSSLPISLQATPTTPATLSASSSAGGSRTPAMSSSSSRVLLRQQLM
RAQAQEQERRERREQAAAAPFPSPAPASPAISVIGVSAGGHTLSRPPPAQVPREVLKVQT
HLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPSSAQPLPAPETAHATGPTG
SAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSGN
LLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFN
INDRIKELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANR
SLQLRIQELELQAQIHGLPVPPNPGLLSLTTSSVSDSLKPEQLDIEEEGRPSTTFHVSGG
PAQNAPPQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEGMVGGLSGGALSP
LRAASDPLLSSVSPAVSKASSRRSSFSMEEES
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtctcatgcagccgagccagctcgggacgccgtagaggccagcgcggagggccctcga
gccgtgttcctgctgttggaagagcgcaggccagctgagtcggcccagctgctcagcctg
aattctttgcttccggaatccgggattgttgctgacatcgagttagaaaacatcctcgat
cctgacagcttctacgagctcaaaagccaacccctatccctccgctccagcctcccaata
tcactgcaggccacaccgaccaccccagctacactctctgcgtcgtcttctgcagggggc
tcccggacccctgccatgtcatcttcttcatcacgggtcttgctgcgtcagcagcttatg
agggcccaggctcaggaacaggagaggcgtgagcggcgggaacaggcagcggccgctccc
ttccccagccctgcgcccgcctcaccagccatctctgtgattggcgtgtctgctggtggc
cacacactgagtcgtccaccccctgctcaggtgcccagggaggtactcaaggttcagacc
cacctagagaaccctacacgctaccacctgcagcaagctcgccggcagcaggtcaaacag
tacttgtctaccacacttgggcccaagctggcttcccaggctctcaccccaccaccaggg
ccttccagtgcccagccacttcctgcccctgaaactgctcatgccaccggtcctacaggc
agtgctcctaacagccccatggcgctgctcaccattgggtccagctcagaaaaggagatt
gatgatgtcattgatgagatcatcagcctggagtccagttacaacgatgagatgctcagc
tatcttccaggaggcactgcagggctgcagctccccagcacgctgcctgtgtctggaaat
ctacttgatgtgtacagcagtcagggagtggctaccccagctatcaccgtcagcaattcc
tgtccagctgagctgcctaacatcaaacgtgagatctccgaaaccgaggcaaaggccctt
ttgaaggagcgacagaagaaagacaatcacaacctaattgaacgacgcaggcgattcaac
attaacgataggatcaaagagctgggcaccctcatccccaagtccaatgatccggagatg
cgctggaacaagggcaccatcctgaaggcatctgtggattacatccgcaaattacagaag
gaacagcaacgctccaaagacctggagagccggcagcggtccctggaacaagccaaccga
agcctgcagctccggattcaggagctagaactgcaggcccagatccatggtctgccggtc
cctcccaacccaggactgctctccctaaccacgagttcggtctctgacagcctcaagcca
gaacagctggacattgaggaggagggcaggcctagcacaacgtttcatgtatcaggagga
cctgcccagaacgctcctccacaacagcctccagcaccaccttcggatgcccttctggac
ctacactttcccagcgaccacttgggagacctgggggaccccttccacctagggctagag
gacattctgatggaggaggaggggatggtgggaggactgtcagggggtgccctgtcccca
ctgcgggctgcttctgaccccctgctttcttcagtatccccggctgtttccaaggccagc
agccgccgtagcagcttcagcatggaagaggagtcctga

DBGET integrated database retrieval system